KEGG   Coprococcus catus: CC1_03310Help
Entry
CC1_03310         CDS       T02584                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cct  Coprococcus catus
Pathway
cct00970  Aminoacyl-tRNA biosynthesis
cct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cct00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CC1_03310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cct03029]
    CC1_03310
Enzymes [BR:cct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CC1_03310
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CC1_03310
Mitochondrial biogenesis [BR:cct03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CC1_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey zf-Di19
Motif
Other DBs
NCBI-ProteinID: CBK79269
UniProt: D4J4J8
LinkDB All DBs
Position
345232..346665
Genome map
AA seq 477 aa AA seqDB search
MREYETVIGLEVHCELATKTKIFCGCTTEFGGEPNTHVCPVCAGMPGTLPVLNKQVVAYA
LSAGVALNCDITQYSKFDRKNYFYPDLPKAYQISQLYLPICRNGHVDIEVDGVKKSIGIH
EIHMEEDAGKLIHDEWEDCTIVDYNRCGVPLIEIVSEPDMRSADEVIAYLEKLRMILQYL
GVSDCKMQEGSLRADINLSVREAGSDKLGTRTEMKNMNSFKAIARAIEGEMNRQIELLED
GKSVTQETRRWDDNKCASYAMRSKEDAQDYRYFPDPDLPPVSISDAWLERVKAAQPEMRD
AKLARYVEEYGLTEHDAAILTESRKMADIFEAAAAICKKPKEVSNWLIVDTMRLLKVHEM
DAADLKFSPDHLAKLIELIDAGTINRPTARDVFEKVFAENVDPEAYVEANGLKIEADDGA
LKGVIEGIVAANPQSVADYHAGKKKAIGFLVGQTMKAMKGKADPGTVNKILAEILNQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatatgaaacagtcattggtcttgaagttcactgtgaactggccacaaaaaca
aagattttctgcggttgtacgacagaattcggcggcgaaccgaatacccatgtctgccct
gtctgcgcaggtatgccaggtactttgcctgttttgaataaacaggttgtagcgtatgcg
ctctcagccggtgtggctttaaattgtgatattacacagtacagcaagttcgacagaaag
aattatttttatccggatcttccgaaggcttaccagatttcacagctctatctgccgatc
tgccgaaatggtcatgtggacattgaagtggatggtgtgaagaagagcatcggcattcat
gagatccacatggaagaggatgcgggaaaactgattcatgatgagtgggaagactgcacc
attgttgattataaccgatgcggtgtgccactgatcgaaattgtcagtgaaccggatatg
cgcagtgcggacgaggtgattgcttacctggaaaagctgaggatgattttgcagtatctg
ggggtttctgattgcaagatgcaggaaggttctctgcgtgcagatatcaacctgtccgtc
cgtgaggcaggcagtgacaaactgggaacccgaacagagatgaagaatatgaactctttc
aaggctattgcccgggccattgaaggggagatgaaccgtcagatcgagcttctggaggac
ggcaaatccgtcacgcaggagacaagaagatgggatgacaataaatgtgccagttatgcc
atgcgttccaaagaagatgcacaggattacagatacttcccggatccggatcttccacct
gtatccatcagcgatgcctggcttgaaagggtgaaagcggctcagccggaaatgcgtgat
gccaagctggctcgttatgtagaagaatatggcctgacagaacacgacgcagccattttg
acggaatccaggaaaatggccgatattttcgaagcggctgctgctatctgcaaaaagccg
aaggaagtttcaaactggttgattgtggataccatgcgtttgcttaaagtacatgaaatg
gatgcggcagatctgaaattctcaccggatcatcttgcaaaattgatcgaactgattgat
gcaggcactatcaatcgaccgacagccagagatgtttttgaaaaggtttttgcagagaat
gtggatcctgaagcttatgttgaggcaaacggtctgaagattgaagctgatgacggtgcc
ttaaaaggcgttattgaaggaattgttgcagctaatccgcagtctgtggcagactatcat
gcaggcaagaagaaagctatcggtttccttgtgggtcagaccatgaaagctatgaaaggc
aaagctgatcctggaacggtgaataagatactggcagaaattttgaatcagtaa

DBGET integrated database retrieval system