KEGG   Coprococcus catus: CC1_33080Help
Entry
CC1_33080         CDS       T02584                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cct  Coprococcus catus
Pathway
cct00473  D-Alanine metabolism
cct00550  Peptidoglycan biosynthesis
cct01100  Metabolic pathways
cct01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CC1_33080
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CC1_33080
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CC1_33080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cct01011]
    CC1_33080
Enzymes [BR:cct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CC1_33080
Peptidoglycan biosynthesis and degradation proteins [BR:cct01011]
 Precursor biosynthesis
  Amino acid ligase
   CC1_33080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 RimK GARS_A ATP-grasp Toxin_31 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CBK81845
UniProt: D4JBX4
LinkDB All DBs
Position
3358843..3359874
Genome map
AA seq 343 aa AA seqDB search
MKIVVLAGGISTERDVSLVSGMGIYKALKSKGHQVMLLDVFLGYANEDWKNVFEKDVDWT
ASVGAIKDQNPDIDAVKALRPDWKKNFFGPHVIDICQQADVVFMALHGENGENGKIQACF
DLNGIRYTGTDYVSSAICMNKAISKDLFAAGGVPTPVGIRLKKGETPDVKVPYPCVVKAC
CGGSSVGVVMANNDEEYAAALEEAFKYDEEVVIEQYIKGREFSVGVVDGKAYPIIEIAPI
HGFYDYKNKYQAGSTIETCPAELSEEKTLAMQAAAEQAFKVLRLKNYARMDFMMDEKEDF
YCLEANTLPGMTPTSLLPQEAKVLGIEYADLCQLLIDISMRDE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtagttttagcaggtggaatcagtacggaacgagatgtttctcttgtatcg
ggaatgggtatttataaagcattaaagagcaaaggtcatcaggtcatgcttttggatgta
tttctgggttatgcgaatgaggactggaagaatgtgtttgaaaaggatgtagactggaca
gcttcagtaggcgctattaaggatcagaatccggatattgatgcagtgaaggcacttcgt
ccggattggaagaagaatttcttcggcccacatgtcattgacatctgtcagcaggcggat
gttgtctttatggcactgcatggtgagaatggcgagaacggaaagattcaggcatgtttt
gatctgaatggtatccgttatactggcacggattatgtaagttcagcaatctgcatgaat
aaagctatttctaaagatttgtttgcagcaggcggtgtgccgacacccgttggcattcga
ttgaagaaaggggaaacaccggatgtaaaggtgccctatccttgtgttgtgaaggcttgc
tgcggcggttccagtgtcggtgttgttatggcgaataatgatgaagaatatgcggcagca
cttgaagaagcgtttaaatacgatgaagaagtcgttattgaacagtatatcaagggtcgt
gaattttctgtaggtgttgtagatggtaaagcgtatccgatcattgagattgcaccgatc
catggcttctatgattataagaataagtatcaggcgggatcgacgattgaaacatgtccg
gcagaactcagtgaagagaagacactggccatgcaggcggcagcagagcaggctttcaag
gtactgcgtctgaagaattatgcacgtatggattttatgatggatgaaaaggaagatttt
tactgtctggaagccaatacactgccgggtatgacaccaacgtcactgctgcctcaggag
gcaaaagtgctgggcattgaatatgcggatctttgccagttattgattgatatttccatg
agagatgaatag

DBGET integrated database retrieval system