KEGG   Cryptobacterium curtum: Ccur_03300Help
Entry
Ccur_03300        CDS       T00962                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ccu  Cryptobacterium curtum
Brite
KEGG Orthology (KO) [BR:ccu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccu01001]
    Ccur_03300
Enzymes [BR:ccu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Ccur_03300
Protein kinases [BR:ccu01001]
 Serine/threonine kinases: Other
  Bacterial family
   Ccur_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase ETRAMP Kdo RIO1 Seadorna_VP7 PepSY_2 DUF3357 Pkinase_fungal KIND CwsA
Motif
Other DBs
NCBI-ProteinID: ACU94057
UniProt: C7MMB7
LinkDB All DBs
Position
complement(382697..384652)
Genome map
AA seq 651 aa AA seqDB search
MIGRVFNNRYQLTERIGIGGMAEVYRAQDRVLGRLVAVKVMLPQYASDPEFTQRFRQEAA
AAANLQSPYIVNVYDWGQDEGIHYMVMEYVRGSDLKTAITQRGAINQRKVAEIGAQVCKA
LSVAHNQDIIHRDIKPQNIMVQPDGNVKVMDFGIARAKNSMKQQTSAVLGTAHYISPEQA
QGKELTPASDIYSLGVVLYEAATGKLPFDGPDSVSVAMKQVSDAPVPPREVNPDLDPNLE
AIILRALEKDPAARFATVNDMKHALNDYLAGRPVSLDDDATHVMSNGTFVPPISNAAGAT
SVMQPLASEGSPVSGAPSVMRAVDEEEQAKHKKRRNAVIVAIIAAVALLVAAIAFALSGM
NGSSMVPDVTGQTAQQAEATLKSAGYTIGTTTEVYDDSTDEGRVVSTDPPAGTTVEKGSA
INLNISKGKGQVEVPDLNGMNADQAKQALTKAGLTASQGTAVASDEVAKDKVATQDPAAG
TKVEKGSTVTFSLSSGPESVSVPDITGMSEKEAQAALSNVGLTGSLSDRKASDKVAEGDI
ISQSPSAGKKVSKGSKVSYVISTGPSVVTVAVPNLTGMTKDGAKSALTEKGLVLGDVTEK
SSDKPKGTVIEQSTDSGTKVEKGSKVNIVISSGQGVLNSLVNPSSSTTTTS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgataggccgtgtattcaataatcgctatcagctcaccgaacgcatcggcatcggtggc
atggccgaggtgtaccgtgcgcaggatcgagtgctcggacgacttgtggccgtaaaagtc
atgctgccccagtatgcttctgatcctgaattcacccaacgcttccgccaagaagctgct
gccgctgctaatctgcagagtccctatatcgtcaatgtatacgactggggccaagatgaa
ggcatccattatatggtgatggaatatgtacgcggcagcgatctcaaaactgctattacg
caacgcggcgccatcaaccaacgtaaggttgctgaaatcggtgcgcaggtatgtaaggcg
ctttctgtagcccacaaccaagacattattcaccgtgatatcaagccgcaaaatatcatg
gttcagcctgacggcaacgtgaaggtgatggactttggcatcgcccgtgcgaagaattcc
atgaagcagcagacctctgcggtgctgggaacagcacattatatatcgcctgaacaggct
cagggcaaagaactcaccccagcgtcggatatttattcactcggcgttgtgctctacgaa
gctgccacgggcaagcttccctttgacggacccgattcggtatccgtagccatgaaacag
gtgagcgatgctcctgtgccgccacgtgaagttaaccccgatctcgaccctaatcttgaa
gctattattttgcgagcgcttgaaaaagatcctgctgcgcgctttgcaaccgttaacgac
atgaagcatgcgctcaacgactacctagctggacggcccgtcagtcttgatgacgatgca
acccatgtcatgtcaaatggtactttcgtcccacctatcagcaatgctgctggcgctact
tcagttatgcaaccacttgcctccgagggctcacctgtaagcggtgcgccctcggttatg
cgcgctgtcgacgaagaagaacaagcgaagcataagaagcggcgcaacgctgttattgtt
gctattatcgctgctgtcgcgctgcttgttgccgctatcgcctttgcactcagcggcatg
aacggcagcagcatggtacccgatgtaacagggcaaacggcccagcaggccgaggctacc
ctgaaatcggctggctacaccataggtacaacaaccgaagtatacgacgactcaactgac
gaagggcgcgtcgtgagtaccgacccgccagctggtacgaccgtcgaaaagggttcagct
atcaacttgaatatttctaaaggtaaaggacaagtagaggtccccgatctcaatggaatg
aatgccgaccaggcaaaacaagcacttaccaaggcggggctaactgcttcacagggtaca
gctgtcgcttctgatgaagtagcaaaagacaaggtcgccacacaagatccagccgccggc
acaaaggttgaaaagggttcaacggtaaccttttcgctctcaagcggccctgaaagtgta
tcggtgccagatatcactggtatgagcgaaaaggaagctcaagctgctctttcgaatgtg
gggcttactgggtctctcagcgaccgaaaggcttctgacaaggtagctgaaggggacatt
atcagccagagcccctcggctggcaaaaaggttagcaagggtagcaaggtgtcgtatgtc
atttccactggcccttctgttgtgaccgtcgcggtacccaacctcacgggcatgacgaag
gacggcgccaagagtgcgttaactgaaaagggtcttgtactgggcgatgtgactgaaaag
tcatctgacaagccaaagggtaccgttatcgagcagagcaccgacagtggcacaaaggtt
gaaaagggttcgaaggtgaatattgtcatcagctctgggcagggtgtgctgaactccctt
gtcaaccccagctcgagcacaaccaccacgagctaa

DBGET integrated database retrieval system