KEGG   Campylobacter cuniculorum: CCUN_0730Help
Entry
CCUN_0730         CDS       T05046                                 

Definition
(GenBank) uracil-DNA glycosylase family protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CCUN_0730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccun03400]
    CCUN_0730
Enzymes [BR:ccun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CCUN_0730
DNA repair and recombination proteins [BR:ccun03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CCUN_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Syja_N
Motif
Other DBs
NCBI-ProteinID: ARJ56348
UniProt: A0A1W6BW73
LinkDB All DBs
Position
723809..724432
Genome map
AA seq 207 aa AA seqDB search
MIRELHYLKAMGYDFIDENLKDENLKNDFSVKNFKDLQNSVKNCTLCHFSKTRRHVLMEK
EQKSVKLLILASFAQKSENESGILLDSLRGENLKKILQEILGLKRENFYFSYLFKCFSYS
KFDNFSLQSCLPFFWNELKLVKPKIVLCLGEYAFEGLGFKNFNALRGEIFAYEDFFIMPS
FELEFIEKNPSYKKDFIDDLKKLKGFL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagaattacactatcttaaagcaatgggttatgatttcatcgatgaaaattta
aaagatgaaaatttaaaaaatgatttttctgttaaaaatttcaaagatttacaaaatagc
gtaaaaaattgcactctttgccatttttctaaaacgcgtcgccatgtcttaatggaaaaa
gaacaaaaaagtgttaaactcttaatcctagcgagttttgctcaaaaaagcgagaatgaa
agcggaattttacttgattctttaaggggtgagaatcttaaaaaaatattgcaagaaatt
ttggggcttaaaagagaaaatttttatttttcttatctttttaaatgtttttcttattca
aaatttgacaatttttcgctacaatcttgtttgccttttttttggaatgagctaaagctt
gttaaacctaaaattgtcctttgtttaggagaatacgcgtttgagggcttaggctttaaa
aatttcaatgctttgcgtggagaaatttttgcctacgaggatttttttatcatgccaagt
tttgagcttgaatttatagagaaaaatcccagctataaaaaagactttattgacgattta
aaaaaacttaaaggatttttatga

DBGET integrated database retrieval system