KEGG   Cupriavidus sp. USMAHM13: BKK81_11360
Entry
BKK81_11360       CDS       T04762                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00970  Aminoacyl-tRNA biosynthesis
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKK81_11360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccup03029]
    BKK81_11360
Enzymes [BR:ccup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BKK81_11360
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BKK81_11360
Mitochondrial biogenesis [BR:ccup03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BKK81_11360
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AOZ01289
LinkDB
Position
1:2595971..2597314
AA seq 447 aa
MLPDLDTLQASLRAGTTSRTAIVEAAQAAAAGPAARSVFLQTSFDEALRVARAADAAALA
GQPLHPLAGLPVSIKDLFDIAGEVTRAAAIARDDAAPADADAAVVARLRHAGAALVGRTN
MSEFAFSGVGINPHFGTPRNPLDPAVARVPGGSSSGAAVSVALGLAVAGLGSDTGGSIRI
PAALCGLTGFKPTTRRVPLTGAFPLSYTLDTACAMTRSVSGCVLVDSVLADTPAMPIGKA
PAAIRLAVARQYLQDDLEPVVAQAFDRALGRLSAAGVRIEHIELPELEELPGLNAAGGFT
AAEAWSIHRHLLATRRAQYDPRVAMRIERGAAMSAADYVDLMRARLDWIARVQARLAGFD
AIVCPTVPMVAPPLDPLLADDALFFRTNGLLLRNTSAFNFLDGCSISLPCHAAGELPVGL
MLSHGPLHDAGLLGIALALEAIVRPAA
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgctgcccgacctcgataccctgcaagccagcctgcgcgccggcaccaccagccgcacc
gccatcgtcgaagccgcccaggccgccgccgccggaccggccgcgcgctccgtgttcctg
cagaccagtttcgacgaggccctgcgcgtggcccgcgccgccgacgccgcagcgctggcg
ggccagccgctgcatccgctggccggcctgccggtgtccatcaaggacctgttcgatatc
gccggcgaggtcacgcgggccgccgccatcgcgcgcgacgacgccgcgccggccgatgcg
gacgcggcggtcgtggcacgcctgcgccatgccggcgccgcgctggtggggcgcaccaat
atgagcgagttcgccttttccggcgtcggcatcaacccccatttcggtaccccgcgcaat
ccgctcgaccccgccgtcgcgcgcgttcccggcgggtcctcctcgggtgccgccgtctcg
gtggcgctggggctggcggtcgccgggctcggcagcgatacggggggctcgatccgcatc
ccggcggcactgtgcggtctcaccggcttcaagccgaccacccgccgcgtcccgctcacc
ggcgcctttccgctctcgtacacgctggacaccgcctgcgccatgacgcgcagcgtgagc
ggctgcgtgctggtggacagcgtgctggccgacaccccggccatgccgatcggcaaggct
ccggcggccatccgcctggcggtcgcgcggcaatacctgcaggatgacctggaaccggtg
gtggcgcaggccttcgaccgcgcgctcgggcgcctgtcggcggccggcgtgcgcatcgag
cacatcgagctgccggagctcgaggagttgccggggctcaatgccgcgggcggcttcacc
gcggccgaagcctggtcgatccatcgccacctgctggccacccggcgcgcccagtacgat
ccgcgcgtggccatgcgcatcgagcgcggcgccgcgatgagcgctgccgactacgtcgac
ctgatgcgcgcccgcctggactggatcgcccgcgtgcaggcgcggctggccggcttcgac
gccatcgtctgtccgaccgtgccgatggtggcgccaccgctggatccgctgctcgccgac
gatgcgctgttcttccgcaccaacggcctgctgctgcgcaacacctccgccttcaacttc
ctggacggctgctcgatctccctgccctgccacgcggccggcgaactgccggtcggcctg
atgctgtcgcacggtccgctgcacgacgccgggctgctgggcatcgccctggcgctggaa
gcgatcgtgcgcccggcggcctga

DBGET integrated database retrieval system