KEGG   Cupriavidus sp. USMAHM13: BKK81_16170Help
Entry
BKK81_16170       CDS       T04762                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccup  Cupriavidus sp. USMAHM13
Brite
Enzymes [BR:ccup01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKK81_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AOZ00606
LinkDB All DBs
Position
1:complement(3664289..3664819)
Genome map
AA seq 176 aa AA seqDB search
MTRVFFGLAMAGAAAALAACSTGNLIGPSTAAATLAAKSGTQTGGTVTFTQQGDMVMVKA
VVTGLAPGSEHGFHVHEKGDCSAPDAMSAGGHFNPEGRPHGSTASPDHHAGDIPNLKADA
NGTARAEFMLHGMSVGTGKDGVIGRAVVVHKDPDDYKSQPAGNSGARIACGVIAAS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgtattcttcggcctggccatggcaggcgccgcggcggcactggccgcctgc
agcaccggcaatctgatcggaccctccaccgcagcggcgacgctggcggcgaaaagcggt
acccagaccgggggtacggtcacctttacccaacaaggcgacatggtgatggtcaaggcc
gtggtgacaggcctggcacccggcagcgagcacggcttccacgtgcacgagaagggcgac
tgctcggcgcccgatgccatgagcgcgggcggccatttcaatccggaaggccgtccgcac
ggctcgaccgcctcgccggaccaccacgccggcgacatccccaacctgaaggccgatgcc
aacggcactgcgcgcgcggaattcatgctgcacggcatgtcggtcgggaccggcaaggac
ggtgtcatcgggcgcgcggtggtggtgcacaaggatccggacgactacaagtcgcagccc
gccggcaattccggcgcgcgcatcgcctgcggcgtgatcgcggcctcctga

DBGET integrated database retrieval system