KEGG   Cupriavidus sp. USMAHM13: BKK81_17930Help
Entry
BKK81_17930       CDS       T04762                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccup00405  Phenazine biosynthesis
ccup01100  Metabolic pathways
ccup01110  Biosynthesis of secondary metabolites
ccup01130  Biosynthesis of antibiotics
ccup01230  Biosynthesis of amino acids
ccup02024  Quorum sensing
Module
ccup_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BKK81_17930
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BKK81_17930
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKK81_17930
Enzymes [BR:ccup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BKK81_17930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AOZ00916
LinkDB All DBs
Position
1:4057622..4058206
Genome map
AA seq 194 aa AA seqDB search
MLLMIDNYDSFTYNLVQYFGELGADVRTFRNDEITLDEIEALGPDHICVSPGPCSPREAG
ISVAVLQHFAGKVPLLGVCLGHQAIGEAFGGKVIRAKQVMHGKVSTIETTQQGVFAGLPR
HFDVTRYHSLAIERETLPDCLEVTAWTPDGEIMGVRHKTLAVEGVQFHPESILSEHGHAL
LANFLKAGSGEVRR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgatgatcgacaactacgattccttcacctacaacctcgtgcagtatttcggc
gaactcggcgccgacgtgcgcaccttccgcaacgacgagatcacgctggacgagatcgag
gccctcgggcccgaccatatctgcgtctcgcccggcccctgcagccccagggaagccggc
atctcggtggccgtgctgcagcacttcgccggcaaggtgccgctgctgggcgtgtgcctg
ggccaccaggccatcggcgaggccttcggcggcaaggtgatccgcgccaaacaggtcatg
cacggcaaggtcagcaccatcgagacgacccagcagggcgtgttcgccgggctgcccagg
cacttcgacgtcacgcgctatcattcgctggcaatcgagcgcgagaccctgcccgactgc
ctggaagtgacggcctggacgccggatggcgagatcatgggcgtgcgccacaagaccctt
gcggtcgaaggcgtgcaattccaccccgaatccatcctgtccgagcacggacacgcgctg
ctggcgaacttcctcaaggcgggctcgggcgaggtacggcgatga

DBGET integrated database retrieval system