KEGG   Cupriavidus sp. USMAHM13: BKK81_28280Help
Entry
BKK81_28280       CDS       T04762                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00010  Glycolysis / Gluconeogenesis
ccup00620  Pyruvate metabolism
ccup01100  Metabolic pathways
ccup01110  Biosynthesis of secondary metabolites
ccup01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BKK81_28280
   00620 Pyruvate metabolism
    BKK81_28280
Enzymes [BR:ccup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BKK81_28280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AOZ03042
LinkDB All DBs
Position
2:complement(2267435..2268955)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLDIEFPYKDRYDNYIGGKWVPPRSGQYFDNISPVTGEVFCQIARSNADDVEL
ALDAAHAAKTAWGRTSPAERANVLNRIADRMEANLKRLAVAETIDNGKPLRETMAADLPL
AVDHFRYFAGTVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVLNVVSGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESVYDRFMERAIKRVEAIKQGHPLDPSTMIGAQASQEQLEKILSYIDLGK
QEGAQLLAGGARNQLGGALDKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDVNRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgccgaaatgaagttcctcgacatcgaattcccgtacaaggaccgctacgac
aactacatcggcggcaagtgggtgcccccgcgctcgggccagtacttcgacaacatctcg
ccggtgaccggcgaagtcttctgccagatcgcgcgctccaacgccgacgacgtggaactg
gcgctggacgccgcgcacgccgccaagaccgcctggggccgtacctcgccggccgagcgc
gccaatgtcctcaaccgcatcgccgaccgcatggaggccaacctcaagcgcctggccgtg
gccgagaccattgacaacggcaagccgctgcgcgagaccatggcggccgacctgccgctc
gcggtcgaccacttccgctacttcgccggcaccgtgcgcgcccaggaaggcggcatctcc
gagatcgaccacgacaccatcgcctatcacttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggccccggcgctggcc
gccggcaactgcgtggtgctcaagccggccgagcagaccccggcctcgatcctggtgctg
atggagatcatcggcgacctgctgccgccgggcgtgctcaacgtggtgagcggcttcggc
ctcgaggccggcaagccgctggcgtcgaacaagcgcatcgccaagatcgccttcaccggt
gagaccaccaccgggcggctgatcatgcagtacgcctcgcagaacctgatcccggtcacg
ctggagctgggcggcaagagccccaacatcttcttcgccgacgtgctcgacaaggacgac
gccttcttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgccctgatccaggaatcggtctacgaccgcttcatggagcgc
gccatcaagcgcgtcgaggccatcaagcagggccacccgctcgacccctccaccatgatc
ggcgcgcaggcctcgcaggagcagctcgagaagatcctctcctacatcgacctgggcaag
caggaaggcgcgcagctgctggcgggcggcgcgcgcaaccagctcggcggcgcgctcgac
aagggctactacgtcaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtggtatcggtgaccaccttcaagaccgaagaggaagcgctg
gaaatcgccaacgacaccctgtacgggctgggcgccggcgtatggacgcgcgacgtcaac
cgcgcctaccgcttcggccgcgagatccaggccggccgcgtgtggaccaactgctaccac
gcctacccggcccacgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcccg
aacgcgctcggcttcttctga

DBGET integrated database retrieval system