KEGG   Cupriavidus sp. USMAHM13: BKK81_30170Help
Entry
BKK81_30170       CDS       T04762                                 

Definition
(GenBank) cellulose synthase catalytic subunit (UDP-forming)
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00500  Starch and sucrose metabolism
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKK81_30170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccup01003]
    BKK81_30170
Enzymes [BR:ccup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     BKK81_30170
Glycosyltransferases [BR:ccup01003]
 Polysaccharide
  Structural polysaccharide
   BKK81_30170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt PilZ Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AOZ04105
LinkDB All DBs
Position
2:2717734..2719896
Genome map
AA seq 720 aa AA seqDB search
MSSRVRGFGNTFVGLPLWNHPGARVAALVVALFLFLLVVTVPLDFWQQVGFAAACFAMAV
WLNRIHGRLATLILVVLSMSASSRYMYWRLTETMSFTNWTDVAFGTGLVLAELYAFAVLM
LGYFQTAWPLKRKPVPMPDDTSTWPTVDVFIPTYNEPLSVVKPTVFAAMSLDWPADKIRV
FVLDDGRREEFRAFCEKVGVAHLTRDNNRHAKAGNINEALKKTDGEFVAIFDCDHIPTRS
FLQICTGWFLKDRKLAMLQTPHYFFSPAPFEKNLRTFQQVPNEGELFYGLVQDGNDLWDA
TFFCGSCAIIRRAPLLEVGGIAVETVTEDAHTALKLHRKGYGTAYLAIPQAAGLATESLS
GHVGQRIRWARGMAQICRLDNPLFGPGLSLPQRLCYLNAMLHFFYGLPRLVFLTAPLAYL
LFGAHVIQASALTIAIFALPHLLHANMTNSRVQGQFRHSFWNEVYESVLAWYIMRPTLVA
FLNPAAGKFNVTPKGGVIEEAYFDWEISRPYLIMLLLNLLGLAVGVMRLFVWQEVETTTV
VLNLIWTVYNLIILGASIAVATETRQIRESHRVAMRLPAALRLADGNTIVCETSDFAEGG
LGLKLPPGCELKKGDAVTVSLYLQEDEHAFTGKVVFHGRSHTGLALDEMTPRQEMEFVQC
TFARADAWIDSWGRKRPDAPRLAARQIMRIGVMGFQNVMFHLGREMRRLLRRPAPQARAR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
ctgtcctcgcgcgtgcggggcttcggcaacacctttgtcggcctgccgctgtggaaccac
ccgggagcacgcgtggctgcccttgtggtcgcgctgttcctgttcctgctggtggtgacg
gtgccgctggacttctggcagcaggtcggcttcgccgccgcctgtttcgccatggcggtg
tggctgaaccggatccacgggcggctggctacgctgatcctggtggtactgtccatgtcg
gcgtccagccgctacatgtactggcgcctgaccgagacgatgagcttcaccaactggacc
gacgtcgccttcggcaccggcctggtactggccgagctgtatgccttcgcggtgctgatg
ctgggctatttccagaccgcctggccgctcaagcgcaaaccggtgccgatgcccgatgac
acctcgacctggccgacggtggacgtcttcatcccgacctacaacgagccgctctcggtg
gtgaagccgaccgtgttcgccgccatgtcgctcgactggcccgccgacaagatccgcgtg
ttcgtgctggacgacggccgccgcgaggaattccgcgccttctgcgagaaggtcggcgtc
gcgcacctgacccgcgacaacaaccgccacgccaaggcgggcaatatcaatgaggcgctc
aagaagaccgacggcgagttcgtcgccatctttgactgcgaccacatcccgacgcgctcc
ttcctgcagatctgcaccggctggttcctcaaggaccgcaagctcgccatgctgcagacg
ccccactatttcttctcgccggccccgttcgagaagaacctgcgcaccttccagcaggtg
cccaacgagggtgagctgttctacggcctggtccaggacggcaacgacttgtgggatgcc
acattcttctgcggctcgtgcgccatcatccggcgcgccccgctgctcgaagtgggcggc
atcgccgtggagacggtgaccgaggatgcccacaccgcgctcaagctgcaccgcaagggg
tatggcaccgcctacctggccattccccaggcggccggcctggccaccgaaagcctgtcg
ggccatgtgggccagcgcatccgctgggcgcgcggcatggcgcagatctgccggctggac
aacccgctgttcggtcccgggctgtcgctgccgcagcgcctgtgctacctgaacgcgatg
ctgcacttcttctacgggctgccgcgcctggtcttcctcaccgcgccgctggcctacctg
ctgttcggcgcgcacgtgatccaggcctcggcgctgaccatcgccatcttcgcgctgccc
cacctgctgcacgccaatatgaccaactcgcgcgtgcagggccagttccgccattccttc
tggaacgaggtctacgagtcggtgctggcctggtacatcatgcgcccgaccctggtcgcc
ttcctcaaccccgccgcgggcaagttcaacgtgacaccgaagggcggcgtgatcgaggaa
gcctacttcgactgggaaatctcgcgcccctacctcatcatgctgctgctgaacctgctg
gggctggcggtgggcgtgatgcgcctgttcgtctggcaggaggtcgagaccaccacggtg
gtgctgaacctgatctggacggtgtacaacctgatcatcctgggcgcttcgatcgcggtg
gccaccgagacgcgccagatccgcgaatcgcaccgcgtggcgatgcgcctgccggccgcg
ctgcgcctggccgacggcaataccatcgtctgcgagaccagcgacttcgccgaaggcggc
ctcggcctcaagctgccgcccggctgcgagctgaagaagggcgacgcggtcaccgtgtcg
ctctacctgcaggaggacgagcatgccttcaccggcaaggtggtgttccacgggcgcagc
cataccggcctcgcgctcgacgagatgacgccgcgccaggagatggaattcgtgcagtgc
acgttcgcccgcgccgacgcctggatcgactcatggggccgcaagcgccccgacgcgccg
cggctggcggcacggcagatcatgcgcatcggcgtgatgggattccagaacgtgatgttc
cacctcggtcgggagatgcgccgcttgctgcgccggcccgcaccgcaggcgcgcgcgcgc
tga

DBGET integrated database retrieval system