KEGG   Campylobacter curvus: CCV52592_0683Help
Entry
CCV52592_0683     CDS       T00576                                 

Gene name
pbpA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ccv  Campylobacter curvus
Pathway
ccv00550  Peptidoglycan biosynthesis
ccv01100  Metabolic pathways
ccv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCV52592_0683 (pbpA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CCV52592_0683 (pbpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccv01003]
    CCV52592_0683 (pbpA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
    CCV52592_0683 (pbpA)
Enzymes [BR:ccv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CCV52592_0683 (pbpA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CCV52592_0683 (pbpA)
Glycosyltransferases [BR:ccv01003]
 Polysaccharide
  Bacterial polysaccharide
   CCV52592_0683 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CCV52592_0683 (pbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: EAU00434
UniProt: A7GZA7
LinkDB All DBs
Position
1291854..1293782
Genome map
AA seq 642 aa AA seqDB search
MKYILAFCFAVAIAFCGAFLYFYAQVRFEAYSIIDYKPKLTTQIFDRNNELIANIFEENR
IYVRYNDIPARVIEALVAIEDTSYFEHGGANYEAIARAVVKDIKAQKLVEGASTLTQQLV
KNLVLTREKKFTRKIKEIVLAIKLENELSKEDIIERYLNHVYFGHGYYGIKTAAEGYFRK
ELNELSIKEIAILVGLPKAPSTYDPTKHLDLSLSRANRVLERMYNIGWINEDEYRKGVLE
EPAVFDDTLTRNKAPYVVDEIIKEASKKFDDIKTGGYRIQSTIDLGVQKMAQDALVYGYN
EILKRDKKANPEMLNGAIVVTQPQSGHILALIGGIDYAKSSYNRATQSQRQPGSSFKPFI
YQIALNSGYSVVSQVADVARTFDMGNGKEWTPKNYSGGFQGYITIKSAITQSRNLATINL
LNDLGLSSVRKKLVEMGFENIPENLSIALGSFGISPLEFAKFYSMFPNEGEIVEPTLIRH
IENSFGAAMDYEGQKKQVLKPEQAFLMTTLLQNVVNNGTGRNAKIQGIQIAGKTGTTNNN
IDAWFCGYTPDIEAIIWYGNDDNSPMKKIEGGGRTAAPVFKKFMEEYIKQYPTLRRVFEQ
PEGVYKGYYDGGDEFYTNDSPLPQMTPLNEIIQDQENEGLIF
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatcttggctttttgttttgccgtggctatcgctttttgcggtgctttttta
tatttttacgcgcaggtgaggttcgaggcttacagcataatcgactacaaaccgaagcta
acgacgcaaatttttgacagaaacaacgaattgatcgcaaatatatttgaagaaaacaga
atttatgtaagatataacgacatccccgcgcgagtcatcgaggcgctagtagcgatcgag
gatacgagctattttgagcatggcggagcgaactacgaagccatagcaagagccgtcgta
aaagacatcaaggcccaaaagctggtagagggcgcatctactttgacgcagcagctggtc
aaaaatttagtccttactcgcgagaagaaatttacaagaaagatcaaagagatagtcctc
gctatcaagcttgaaaacgagctttctaaagaagatatcatagaaagatacctaaatcac
gtctatttcggacatggctactacggtataaagacggctgccgagggatatttcagaaaa
gagctgaacgagcttagcataaaagagatcgccattttagtcggcctgccaaaagcacct
agcacatacgatcctacaaaacaccttgacctctcgctaagccgcgcgaaccgcgtgctc
gagcgtatgtataacatcggctggataaacgaggacgaataccgaaaaggcgtgctggaa
gagcctgcggtgtttgacgatacgctcactagaaacaaagccccttacgtagtcgacgag
atcatcaaagaggcctctaaaaaatttgacgacataaaaactggcggataccgcatacaa
agcaccatcgatcttggcgtgcaaaaaatggcgcaagacgcgctagtatatggatacaat
gaaattttaaagcgcgacaaaaaggcaaaccctgaaatgctaaacggcgccatcgtcgtg
acccagcctcaaagcgggcatattttagcactcatcggcgggatagactacgcaaaaagc
agctacaaccgcgcaactcaaagccagcgccagccaggatcgagcttcaagcctttcata
tatcaaatagcccttaacagcggctactcggtcgtctctcaagtagccgacgtcgcacgc
acttttgatatgggaaatggcaaggagtggacgcctaagaactatagtggaggctttcag
ggctacatcacgatcaagtccgccatcactcagtcgcgcaacctggcaaccataaattta
ctaaacgaccttggcctcagctcggttcgtaagaagctggtcgaaatgggctttgaaaat
atccctgaaaatttatccatcgcacttggaagctttgggatctcgccgcttgagtttgcg
aaattttactcgatgttcccaaatgaaggcgagatagtcgagcctactttgataagacac
atcgaaaacagctttggagcggcgatggactacgaagggcaaaaaaagcaagtgcttaag
cccgagcaggcatttttgatgactactctgcttcaaaacgtcgtaaataacggcaccgga
cgaaacgcaaagatacaaggcatacaaatagcaggcaaaaccggtaccacaaataacaac
atagacgcgtggttttgcggatacactccggacatcgaggccatcatctggtacgggaac
gacgataactcaccgatgaaaaagatcgagggcggcggcaggacggcggcgccggtattt
aagaaatttatggaagagtatataaagcaatatccgacgctcagacgggtatttgagcaa
cccgagggcgtttataagggctactacgatggtggcgacgagttttacaccaacgactcg
cctttgcctcagatgacacctctaaacgagatcattcaagatcaggagaacgaaggtttg
attttctaa

DBGET integrated database retrieval system