KEGG   Campylobacter curvus: CCV52592_0690Help
Entry
CCV52592_0690     CDS       T00576                                 

Gene name
ftsI
Definition
(GenBank) cell division protein FtsI / penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ccv  Campylobacter curvus
Pathway
ccv00550  Peptidoglycan biosynthesis
ccv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCV52592_0690 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CCV52592_0690 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
    CCV52592_0690 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccv03036]
    CCV52592_0690 (ftsI)
Enzymes [BR:ccv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CCV52592_0690 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CCV52592_0690 (ftsI)
Chromosome and associated proteins [BR:ccv03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CCV52592_0690 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF3764
Motif
Other DBs
NCBI-ProteinID: EAU00432
UniProt: A7GZA1
LinkDB All DBs
Position
1283725..1285560
Genome map
AA seq 611 aa AA seqDB search
MNPKKSKITILFLFITFGIIIFVAVIFYRATIERRLPKLQTSEINTALRGNIVTKDGFSV
SSSQKLYKVMLDTRNIDPNKKEMFIKLYSLYSGDDPDKVRKIINATKGLVTLSYSIDAKG
ATYLQELSRKLNRKSILISYQDPKTGLASFQGMRIMESGQNRLFMSKSALTPVIGYVNKT
ESDALTKSKGVKGLEKYYEDYLAPIQNAKILGPRDIGNNIILTSDSNLANRVDGYNAVLS
IPLKFQTKIEQILDDRREFLDAKELVICIMNSKNGEILALASSSRYDPSNIKKQDYGALN
STATEYAYEAGSVFKPFVFALLLQEKKVNPFELVNTYNGRYQLGKRIIKDTHPEPFMSAE
DVIVHSSNIGMIQLVERLNGPQIYQGLLNFGFSRKSGIDMPYEQVGMMPTVNKLNSSTYK
ATVSYGYGLQATFMQLLKAYNTFNNKGVEVTPHIVEFLEKNGKRFELPKPEPQQVISQET
AKVMKRILIKTVEKGTGLKAMTPGLEVGGKTGTAHIASGKGGYSNTYNGSFFGFANDTKG
NSYTIGVLARDPKKPYYYFGAQSALPTFKKAIDLMIEEGYLVPDQQVIAEFEAKKEKQKD
EKAKPQKQILD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaaaaaatcaaaaataaccatactttttttatttatcacatttgggatcata
atctttgtcgccgtgatattttaccgagcgacgatcgaacgcagactgcctaaactccaa
actagcgagataaataccgcacttcgcggcaatatcgtgacaaaggacggctttagcgtc
tcctccagccaaaagctctataaagtcatgctagacaccagaaacatcgatcctaacaaa
aaagagatgtttatcaagctttattcgctttatagcggcgacgatccggataaagtaaga
aaaataataaacgccaccaaagggcttgtcacgctatcttacagtatcgatgcaaagggt
gccacataccttcaagagctttcaagaaagctaaacaggaaaagcatcttgatctcctat
caagacccaaagacagggctggcttcctttcaaggtatgcgtataatggaaagcggacaa
aacaggcttttcatgtcaaaaagtgcgctgacgccggtcatcggatacgtcaacaaaacc
gagagcgacgcgctcacgaaaagtaaaggcgtaaaagggctcgaaaaatactacgaggac
tatctagcgccgatacaaaacgccaaaattttaggccctagagatataggcaacaacata
atcctaacaagcgactcaaatctagcaaacagagtggacggctacaacgcggtgctctcc
ataccgctgaaatttcaaaccaagatcgagcagatcctagacgataggcgagaattttta
gacgctaaggagcttgtcatttgtataatgaacagtaaaaacggcgaaattttagccctc
gcctcaagctccagatacgatccctcaaatatcaaaaagcaagactacggcgcattaaat
tctaccgcgacagaatacgcatacgaggctggttcggtgtttaagccctttgtcttcgct
ctcttgcttcaagaaaaaaaggtaaatccttttgagctcgtaaatacctacaacggccgc
tatcagcttggcaagcgcatcatcaaagacactcacccggagccctttatgagcgcggaa
gacgtcatcgtgcatagctcaaatatcggcatgatacagctagtagagcgattaaacggt
ccgcaaatttatcaagggcttttaaatttcggcttttcaagaaagagcggtatcgatatg
ccatacgagcaagtaggcatgatgccgacggtaaataagctaaattcctccacctacaaa
gcgaccgtgagctatggatacggcctgcaagcgacattcatgcaacttttaaaagcctac
aacacttttaacaacaaaggcgtcgaggtcacgcctcatatagtcgaattcctggagaaa
aacggcaagcgcttcgagctgccaaagcctgaaccccagcaagtcatcagccaagaaacg
gcgaaggtcatgaaacgcatactcatcaaaaccgtagaaaagggaaccggtctaaaggcg
atgacaccgggtcttgaagtggggggcaaaacgggaacggcacacatagcctccggaaaa
ggtggatacagcaacacctataacggctcgttttttggctttgcaaacgacaccaaaggc
aacagctacaccatcggcgtactagcgcgcgatcctaaaaagccgtattattactttggt
gcgcaaagtgcgctaccgacctttaaaaaagcgatcgatctaatgatagaagagggatat
ctcgtgcccgatcaacaagtcattgctgaatttgaagccaaaaaagagaagcaaaaagac
gagaaagcaaagccgcaaaagcaaattttagactga

DBGET integrated database retrieval system