KEGG   Campylobacter curvus: CCV52592_1152Help
Entry
CCV52592_1152     CDS       T00576                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccv  Campylobacter curvus
Pathway
ccv00473  D-Alanine metabolism
ccv00550  Peptidoglycan biosynthesis
ccv01100  Metabolic pathways
ccv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCV52592_1152 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCV52592_1152 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CCV52592_1152 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
    CCV52592_1152 (ddlA)
Enzymes [BR:ccv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CCV52592_1152 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ccv01011]
 Precursor biosynthesis
  Amino acid ligase
   CCV52592_1152 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: EAT99804
UniProt: A7GYC3
LinkDB All DBs
Position
942270..943313
Genome map
AA seq 347 aa AA seqDB search
MKLGVVFGAKSFEHEISIVSAIVLKNVLKQELSFIFCDKERKFYLIEPTDMRANFFSSGK
YKKCKKLFLMACGFYTHSLFGVKRLEVDVYINLIHGMDGEDGKFASLFDFYGISYIGPRL
EASVMSYNKELTKFLAQKVGVKTLDYEMITYEELPKFALPIILKPARLGSSIGVSVVKDE
SEFEYARDVAFEFDKEVLVEPFIEGVKEYNLAGCMIDGKMRFSIVEEPKKKEFLDYEQKY
MSFSNESKAQEARIDEELRDRLKENFVKIYGFGFEGAIIRCDFFVIEGEVYLNEINPNPG
SLANYLFEDFEAMLNALAASRLPKERKINIDYKFINSITSAKGSGKI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggtgtagtttttggggctaagagctttgaacacgagataagtatagtaagc
gcgatcgtgcttaaaaacgtcctaaagcaggagctaagctttatcttttgcgacaaggag
cgtaaattttacctgatcgagcctaccgatatgagagcgaattttttcagctcgggcaaa
tataaaaaatgcaaaaagctgtttttgatggcgtgcggattttatacgcattcgcttttt
ggcgtgaagcgcctggaggtagatgtttatataaatttgatacacggcatggacggcgag
gacggtaaattcgcttcgttgttcgatttttacgggatcagctatatcgggccgcgcctt
gaggctagcgtgatgagctacaacaaggagctgactaaatttttagcgcaaaaagtaggg
gtgaaaacgcttgattacgagatgataacatatgaagaactgcctaaatttgcactgcct
atcatactaaagccggctcgtcttggtagctccataggcgttagcgtcgtaaaagacgag
agcgaattcgaatacgccagagacgtcgcctttgagtttgataaggaggtgctggtagag
ccgtttatcgagggtgtcaaggagtataatctagccggttgcatgatagatggcaagatg
agattttctatcgtcgaagagccaaaaaagaaggaattcctcgactacgagcaaaagtat
atgagcttttctaacgaaagcaaggcgcaagaggctaggatcgacgaagagctgcgagat
agactaaaggaaaattttgtcaaaatttacggctttggctttgagggtgcgataatacgc
tgtgactttttcgtaatagagggtgaagtctatctaaatgagataaatccaaacccgggc
agcctcgcaaactatctattcgaggactttgaggcgatgttaaatgcgcttgcggcaagc
agactgccaaaagagcgaaagataaatatcgactataaatttataaattccatcacttct
gcaaagggaagcggtaaaatttag

DBGET integrated database retrieval system