KEGG   Corvus cornix (hooded crow): 104684197Help
Entry
104684197         CDS       T03546                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104684197 (SOD1)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104684197 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104684197
NCBI-ProteinID: XP_010389696
LinkDB All DBs
Position
Unknown
AA seq 142 aa AA seqDB search
CQSACGDKSSPLKGTGPVKVTGKITGLADGEHGFHVHEFGDNTNGCTSAGPHFNPERKQH
GGPSDAERHVGDLGNVTAKGGVAEVEIQDPVISLSGPHCIIGRTMVVHEKRDDLGRGGDN
ESKLTGNAGPRLACGVIGIAKS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
tgccaaagtgcttgtggtgataaatcctctcctttgaagggtactggaccggtgaaagtc
actgggaaaatcactggattggccgatggggagcacggcttccacgtccatgagttcggt
gacaacaccaatgggtgcaccagtgctggcccccacttcaacccggagcggaagcagcac
ggggggcccagcgatgccgagaggcacgtgggagacctgggcaatgtgactgccaaagga
ggtgtggccgaagtggagatccaggatcccgtcatttccctctctggaccacactgcatc
attggccgtaccatggtggtgcatgagaagcgggatgacctgggcagagggggagataac
gagagcaagttaactggaaacgcagggccccgcttggcctgtggagtgattgggattgcc
aagagctaa

DBGET integrated database retrieval system