KEGG   Corvus cornix (hooded crow): 104684825Help
Entry
104684825         CDS       T03546                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00052  Galactose metabolism
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
ccw04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104684825
   00500 Starch and sucrose metabolism
    104684825
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104684825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccw04147]
    104684825
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104684825
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104684825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104684825
NCBI-ProteinID: XP_010390716
LinkDB All DBs
Position
Unknown
AA seq 926 aa AA seqDB search
MKSYQKLTTTQPAACRVEEEGAAPLPTGRGKLARWWVGSGLLVVAVLLSTITVWVLRQVS
GSWLGPTPPQKCLLVPESHRFDCYPERQVVVTQELCENRGCCFIQTPPPAEGKRGVPWCF
YPPDFPSYTLESLNQTALGMAGLLVRREKAYYPRDIERLRLDVEFETDTRLHIKITDAAN
PRYEVPLDVPRVMKRAENPIYSLNFSWDPFGVLLQRKATGTVLLNTTVAPLIFADQFLQI
STSLPSKFLYGLGEHRGSFLHSLDWNTLTLWARDVSPTESFNLYGAHPFYLLMEEGGDAH
GVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPNPNMVIQQYQQVIGFPAMPPLWA
LGFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRDFTLDSQKFASLPSLV
QDLHKHGQHYVMILDPGISSTSPHGSYWPFDEGLRRGLFLNTTQGQPLIGQVWPGFTAFA
DFSNPDTHQWWLENLQHFYAHVPFDGLWIDMNEPSNFMDGSEDGCPPGDFDSPPYTPAVL
GDSLSAKTVCASAKQKASVHYNLHNLYGLMEAKATASALVQIRAKRPFVISRSTFPSQGR
YSGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFY
PFARNHNTQNEKAQDPTVFSPAARTAMKDVLLTRYSLLPFLYTLFHHAHLQGDTVARPLF
FEFPWDVATWELDRQFLWGRSLLVTPVLEPGVDSVTGYVPQGMWYDFYTGSSVNSSGEML
KMSAPLEHLNLHIREGSVLPTQKPGTTTEVTRGNPLRLIVALSSHATAWGDLFWDDGESL
DTFEQGNYSYVVFNVTQNIFTSTVLHASTEATKVTIGTLSIFGVQKPPSKVLLNGQEKPF
SYLDNQVLTVSDLGISLSQGFSLQWL
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcataccagaagctgacaacaacacagccagcagcatgccgggtagaagaggaa
ggggctgccccgctgcccactggccgagggaagctggcccggtggtgggtgggcagcggg
ctgctggtggtcgctgtgctgctgagcaccatcactgtctgggtgctgcgccaagtatcg
gggagctggctcggacccacgccaccccagaaatgtctcctggttcctgagagccatcgc
tttgactgctaccccgagcggcaggtggtggtgacccaggagctctgtgaaaaccgaggg
tgctgctttatccagactcccccaccagcagagggcaagcggggggtgccctggtgcttc
tatccccctgacttccccagctacaccctggagagcctcaatcagacagcgctgggcatg
gcggggttgctggtgcgaagggagaaggcctattacccccgggacatcgagaggctgagg
ctggatgtggagtttgagacagacacgcggctgcacatcaagataacagatgcagccaac
ccacgctatgaggttcccctcgatgttccccgggtgatgaagagagcggaaaaccccatc
tacagtctgaacttctcctgggacccctttggggtgctgctgcagcgcaaggcaacaggg
acagtgctgctcaacaccaccgtggcccccttgatctttgctgaccagtttctccagata
tccacatcactcccatccaagttcctctatgggctgggggagcaccgtggcagcttcctg
cacagcctggactggaacaccctcacactgtgggcccgcgatgtctctcccacggaatca
ttcaacctgtacggcgctcaccccttctacctgctgatggaggagggtggagatgctcat
ggagttttcctcctcaacagcaacgccatggaggtggccctgcagcctgctccaggcctg
acctggaggaccattggaggggtgctggatttttacatctttctggggcccaatcccaac
atggtcatccagcagtaccagcaggtgataggtttcccagccatgccacccctctgggcc
ctcggcttccacctctgccgctggggctacggatccagcaatgagacctggcagaccgtg
agagccatgaggaactaccagatcccccaggatgcgcagtggaatgacatcgattacatg
gacgggtaccgggacttcaccttggattcccagaagtttgcctccctcccctcactggtg
caagacctccacaaacatgggcagcactacgttatgatcttggatcctggcatcagcagc
accagccctcacggctcctattggccttttgatgaaggcttgagacggggcttgttcctc
aacaccacacaagggcagccactcatcgggcaggtctggcctggtttcactgccttcgca
gacttttccaacccagacacacaccagtggtggctggagaacctgcagcacttctatgcc
cacgtgccctttgacggcctctggatcgacatgaatgagccatccaacttcatggatggg
tctgaggatggctgccccccgggagacttcgacagcccaccctacactccggccgtgctg
ggcgattccctctctgcaaagacggtgtgtgcctcagcaaagcagaaagcctcggtgcac
tacaacctccacaacctctacgggctgatggaagccaaagccacagcaagcgctttagtc
cagatccgggcgaagcgccccttcgtcatctcccgctccaccttccccagccagggccgg
tactcagggcactggctgggtgacaaccggagccagtggaaggacatgtattactccatt
ccagggctgctgagcttcagcctctttggcatcccgctggtcggggcggacatctgcggc
ttctccggcagcacctcggaggagctgtgcacccgctggatgcagctcggtgccttctac
cccttcgctcgcaaccacaacacccagaacgagaaggcccaggacccaacggtgttcagc
cccgcagccaggacggccatgaaggacgtgctgctgacacgctactccctcctgcccttc
ctctacacccttttccaccatgcccacctgcaaggggacactgttgcccggcccttgttc
tttgagttcccttgggatgtggccacatgggagctggacaggcagttcctgtggggccgg
agcctgctggtaacaccggtgctggagcctggggtggactcagtcacaggttatgtcccc
caaggcatgtggtatgacttctacacgggctcctcagtgaacagcagtggggagatgttg
aagatgtcagcccctctggagcacctcaacctgcacatccgggaaggttccgtcctgccc
acccagaaaccaggaaccaccacggaggtgacccgagggaaccccctgcgtctcatcgtg
gccttgtcctcacatgccactgcatggggggaccttttctgggatgatggcgagagcttg
gacaccttcgagcaaggcaactactcctacgtggtgttcaatgtcacacagaatatcttc
acctccaccgtcctccatgccagcactgaggccaccaaggtcaccattggcacactgagc
atctttggggtgcagaagccacccagcaaggtcctcctgaacggccaggagaaacccttt
tcctacctggacaaccaggttctcaccgtgagtgaccttggcatcagcctcagccagggc
ttctccctgcagtggctgtga

DBGET integrated database retrieval system