KEGG   Corvus cornix (hooded crow): 104685418Help
Entry
104685418         CDS       T03546                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00350  Tyrosine metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104685418 (GSTZ1)
Enzymes [BR:ccw01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104685418 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 104685418
NCBI-ProteinID: XP_010391586
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MASEKPILYSYFRSSCSWRVRIALALKGISYDLVPVNLIKDGGQQFSAEFKALNPMQQVP
ALKIDGITISQSLAIINYLEETHPNPRLLPQDPKKRAQVRMIADHIASGIQPLQNLSVLK
QMGEKKMEWAQNCIASGFQALEQILQHTAGRYCVGDEVSMADLCLVPQVANAERFKVDMG
PYPTITRINKALLELEAFKISHPSRQPDTPAELRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaaaagccgatactttacagctatttccgaagttcctgttcttggagagtg
cgaatcgcactggctctgaaaggaatttcttatgacctggtcccagtgaacctcattaag
gatggaggacagcagttttctgctgaattcaaggcactgaatccaatgcagcaagtccca
gccttgaaaattgatggcatcaccatttctcagtcactagctataattaattacctagaa
gagacacatcctaaccccaggctcctgccccaagatccaaagaagagagcccaagtcaga
atgatcgctgatcacattgcctctggcattcaaccactccagaacctgagtgtcctcaaa
caaatgggggagaaaaaaatggaatgggctcagaactgtatcgcgtctggctttcaagca
ctggagcagattctgcagcatactgctggacgctattgtgtgggggatgaagtttccatg
gctgatctgtgtttagtgcctcaagttgccaatgctgaaagattcaaagtggacatgggt
ccataccccacaataaccagaataaacaaagctctcctggagttagaggccttcaaaatc
agccacccttcccggcagccagatactcctgcagagctgcgagcttga

DBGET integrated database retrieval system