KEGG   Corvus cornix (hooded crow): 104685847Help
Entry
104685847         CDS       T03546                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00020  Citrate cycle (TCA cycle)
ccw00190  Oxidative phosphorylation
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104685847 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104685847 (SDHA)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104685847 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 104685847
NCBI-ProteinID: XP_010392197
LinkDB All DBs
Position
Unknown
AA seq 645 aa AA seqDB search
MNWPAACQAPARNLHFTVYGKKNASTKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFG
LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAI
HYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHS
LLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGY
GRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILI
NSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATR
LPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACG
EAASASVHGANRLGANSLLDLVVFGRACALTIANTCKPGEPVPPIKPNAGEESVANLDKL
RFADGSIRTSEARLNMQKAMQNHAAVFRTGSVLQEGCEKLSQIYGDLAHLKTFDRGIVWN
TDLVETLELQNLMLCALQTIYAAEARKESRGAHAREDYKLRVDEFDYSKPLQGQQRKPFE
EHWRKHTLSYVDIPTGKVTLKYRPVIDRTLNEQDCQTVPPAIRSY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaattggccagcagcatgccaggctcccgcacggaacttgcacttcacagtctatgga
aagaaaaatgcctccacaaaggtttctgactcgatttctacccaatacccagtagtggac
catgagtttgatgcagttgttgtgggtgcaggaggagcaggcctgcgggctgcctttggt
ttgtcagaagctgggtttaacacagcctgtgttaccaagctgtttcccacccgctctcat
actgttgctgcacagggagggatcaatgctgctctgggcaacatggaggatgataactgg
aggtggcatttctatgacacagtgaaagggtcggactggctgggtgaccaggatgccata
cactacatgactgagcaagccccagctgctgtgatagagctggaaaattacgggatgcca
ttcagcagaactgaagaaggaaaaatctatcagcgtgcgttcggtggacagagtcttcag
tttggaaaaggaggacaggcccacagatgctgttgtgttgcagacaggactggacattca
ctcttacatactctgtatggcaggtctctacgatacgatacaagctactttgttgaatat
tttgccttggacctacttatggagaatggagaatgccgtggtgttattgccctctgcatt
gaagatggaactatacatcgttttagggcaaaaaacacggtcattgccactggtgggtat
ggccgcacttatttcagctgcacatctgctcataccagtactggtgatggcactgccatg
gtcacacgagctgggcttccttgccaggacttagaatttgtgcagtttcaccctacaggt
atctatggggctggctgccttatcacagaaggatgtcgtggagagggaggtattctaatc
aacagtcaaggtgaaagattcatggagagatacgcacctgttgccaaggatctggcttct
agggatgtagtgtctcgctctatgaccatagaaatccgtgaaggaaggggttgtggtcct
gaaaaagatcatgtgtacctgcagttgcaccacttgccaccacagcagctggcaacccgt
ctcccagggatttccgaaacagccatgatatttgctggagttgatgtcactaaagagcct
atccctgttctgcctactgtgcattataatatgggaggtattcctactaactacaaagga
caggtgatcacacacgtgaatggtgaggataaggtggtgcctgggttatacgcctgcggg
gaagcggcctctgcatctgtccacggtgcaaatcgacttggagctaactcccttctggat
ttggtggtcttcggtcgtgcttgtgccctgactattgcaaatacatgcaagcctggagag
ccagttccccccattaaaccaaatgctggtgaagagtcagttgctaatcttgacaagtta
aggtttgctgatggaagcataaggacttcagaagcacgacttaacatgcagaaggcaatg
caaaaccatgctgctgtatttcgtactggttctgtactccaagaaggctgtgagaaactt
agccaaatttatggtgatctggctcatctaaagacttttgacagaggtattgtgtggaac
actgacttggtggagacccttgaactgcagaacctgatgctctgtgccctacaaaccatt
tatgctgcggaggctcgcaaagagtcccggggtgcccatgccagagaggattataagtta
cgggtagatgagtttgattactctaagccactccaaggccaacagcggaagccatttgag
gagcactggagaaagcacacgctttcctatgtggatatcccaactgggaaggttactttg
aagtacagaccagtgatcgacagaactttgaacgagcaggattgccagaccgtcccacca
gccattcgctcgtactaa

DBGET integrated database retrieval system