KEGG   Corvus cornix (hooded crow): 104685994Help
Entry
104685994         CDS       T03546                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells-like isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    104685994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccw03400]
    104685994
DNA repair and recombination proteins [BR:ccw03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     104685994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 104685994
NCBI-ProteinID: XP_010392429
LinkDB All DBs
Position
Unknown
AA seq 1195 aa AA seqDB search
MGVQGLWKLLECTGRPINPETLEGKILAVDISIWLNQAIKGARDRSGISVRNAHLLTLFH
RLCKLLFFRIRPVFVFDGEAPLLKRQTLAKRRQRKEIAINDSRKTTEKLLKTLLKRHVIK
TAVTGKSNEAFPSITQVRREGIDDMYVLPALENEEKNSSEEEEEKEWQMRMSQKMMLQEQ
LCENPYSIDIESEDFHKLPPEIKHEILTDIKELTKRRRTLFEAMPEDSNDFSQYQLRGLL
KKSNLNRCIENVQKEMNQQHSGEIQTQYENEGGFVKEVESRRVVSEETSHYILIKGIQAK
EAMSRDLETTAGPSSKMHELTKLNKINESPANAKLAASDKMQTEKDDSVVAAPPSPRTLL
AIQAAMVESSSEEELDAGQLNMDQFVSEEGSVSPRTLRAIQQALSEDDKREEVFTATTDG
VLSERPEVKDFLLSSSDEEEQTAEVKEGKNIPTATIHSSIQVTMQDAEFKQKSQELEKRH
VTPKDTGISRDENYSAIENTRKGKELTDKEENDSENHIAPKDTSMSIAETYIDNTIKDTE
DVDKEENGSENHISPKDTSVSRTENCSYIDNTRKGNEDLDKLKNGSKMDLKSPGDKDMNL
SVQKPSCSPVQTGIEALIHAETTELSKNEENLKMSENTQEVISQTVENVSGNISSFPGAR
DHEEEREGMSQSEDSDSGGSFIEVDAEISNEAEFPTKYGEKLGDETALPEVETDRPDVVT
QDLLKESDEVQLGNIQNVEREADGKDAVDEWQDISLEELEELEKDLSAEQNTLQSQKQQQ
ERVAASVTGQMFLESQELLRLFGIPYIEAPMEAEAQCAILDLTDQTSGTITDDSDVWLFG
ARHVYKNFFSQNKYVEYYQYVDFQNQLGLDRSKLINLAYLLGSDYTEGIPNVGFVTAMEI
LNEFPGHGLEPLLKFAEWWNEAQKNKKLRPNPRDTKVKKKLRELELYSGFPNPAVAEAYL
KPVVDESRGSFTWGKPDVEQIREFCKDHFGWTRTKIDGILLPVMKQLNLQQTQLRIDSFF
RLEQHEKQAIKSQRLRRAVTCLKRKEKEADDEIQETATAVTEVELTQPGKRKGEGTAGGA
NQAVATKVQSGKRRKHSDSRKEFLYGGGFVGNLHLSETSSDSSVEESKGRDLGKSKRRKN
MSATETEDLKEKKGCSSSSGEDEDLGNVVMVTAKPVFEGRKKRLRSKRGIRNKMS
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcaaggactttggaagctgctcgaatgcaccgggagacccataaacccagaa
acactggaagggaaaattcttgctgttgatatcagtatttggttgaaccaagcaataaag
ggagccagagatcgtagcggtatttctgtacggaatgctcacctcctcactctgttccat
cgactctgcaagttactgtttttccggattcgacctgtctttgtttttgatggagaagca
cctcttctgaagagacaaaccttggctaagcgaagacaaagaaaggaaattgccatcaat
gattccaggaaaactacagagaaactcttaaaaacacttttgaagagacatgttatcaaa
actgctgttacaggcaaaagcaatgaagcttttcccagtattacacaagttcgaagagaa
ggaattgatgatatgtatgtattgcctgctttagagaatgaagagaagaacagctcagag
gaggaggaagaaaaagaatggcaaatgagaatgagccaaaaaatgatgttgcaagaacag
ttatgtgaaaatccttattctatagatattgaatcagaagatttccacaaactgcctcca
gaaataaaacatgagatcttgactgacattaaagaacttacgaagcgaagaagaacattg
tttgaagcaatgccagaggactccaatgacttttcccagtaccagcttaggggtttgctt
aaaaaaagcaacctcaatcggtgcatagaaaatgtacaaaaagaaatgaatcaacagcac
tcgggtgaaatccaaacacaatatgaaaatgaaggtggttttgtgaaagaagtggaatca
agaagggtggtctctgaagagacttctcactatattctgataaagggtattcaagcaaaa
gaagctatgagtagagacttggaaactactgcaggaccctcatcaaaaatgcatgaattg
actaaattaaataaaatcaatgaatctcctgctaatgcaaagctggctgcatctgacaag
atgcagacagagaaagatgacagtgtggtggcagcgcccccctctcctcggactttgctt
gctatccaggcagctatggtagaaagcagctcagaagaagaacttgatgcagggcaattg
aacatggaccaatttgtatcagaggaaggcagtgtgtccccaagaacactgcgggcaatt
cagcaagctctgagtgaagatgataaaagggaggaagtttttactgctacaactgatgga
gtgctgtcagaaagaccagaagtgaaggattttctgcttagtagctcagatgaggaagag
cagactgctgaagttaaagagggaaaaaacattcctacagctacaattcattcatcaatc
caagtgactatgcaagatgctgaatttaaacagaagagtcaggagttggaaaaacgtcat
gttacacccaaagacactggtatatccagagatgaaaattattctgctattgaaaatact
agaaaaggcaaagaacttacagacaaagaagaaaatgattcagaaaatcatattgcaccc
aaggacaccagtatgtctatagctgaaacttatattgacaatactataaaagacacagaa
gatgtagacaaggaagaaaatggttctgagaatcatatttcaccaaaggataccagtgtg
tccagaactgaaaattgttcttatattgacaatactagaaaaggcaatgaagacttagac
aaattaaaaaatggttccaaaatggacttaaagtctccgggagataaggatatgaatttg
agtgtgcagaagccaagctgttcccctgtgcaaactggtatagaggctttgattcatgct
gaaacaacagagctttctaaaaatgaggaaaacttgaaaatgtctgaaaatacacaggaa
gtaatttcccaaacagtggaaaatgtatctgggaatattagttcatttccaggagcaagg
gatcatgaggaggaaagagaagggatgtcacagtccgaagacagtgattctggtggaagc
tttattgaagtggatgctgaaatcagtaatgaggctgaatttcctactaaatatggtgaa
aaactgggtgatgaaacggcacttccagaagtggagacagacagacctgatgttgtcaca
caggacttgctgaaggagtctgatgaagtgcagttgggaaacattcagaatgttgaaaga
gaagctgatggtaaagatgcagtggatgagtggcaagacatcagtttggaagaactagaa
gaattagaaaaggacctttctgctgagcagaatacgcttcagtctcaaaaacagcagcag
gaacgtgttgctgcttctgtaacaggacagatgttcttggaaagccaggagctcctccgt
ctgtttggcattccatatattgaagctccgatggaggcagaggcacagtgtgccatactg
gaccttactgatcagacctctgggacaatcactgatgacagtgatgtttggttgtttggt
gcacgacatgtttataaaaatttcttcagtcagaacaaatatgtagaatattatcaatat
gttgactttcagaaccagctagggttagatagaagcaagctaattaatttggcgtacttg
cttggaagtgactacactgagggcatcccaaatgttggctttgtaacagcgatggagatt
ttgaatgaatttcctgggcatggcttggaacctctcttaaaattcgctgagtggtggaat
gaggctcagaagaataagaaactgaggcctaatccacgtgataccaaggtcaagaagaag
ctgcgagagctagagctttattcaggtttcccaaatccagcagtggcagaagcatacctg
aagcctgtggtagatgagtcaaggggttcgttcacttggggaaagcccgatgtagagcag
atcagggaattctgcaaggatcactttggctggactaggacaaagatagatggaatcctt
ttgcctgtgatgaaacagctgaacttgcagcagactcagcttcgaattgattcattcttc
agactagaacagcatgaaaaacaagctattaaaagtcagagactgcgcagagctgtgact
tgtctgaagagaaaggaaaaagaagcagatgatgaaattcaggaaacagccactgctgtt
acagaggtggaacttacacagcctgggaaaaggaaaggggaaggtaccgcaggcggtgca
aatcaagctgtggcaacaaaagtacagagtggaaagagaagaaaacattcagattccaga
aaagaatttttgtatggaggtggttttgttggaaatttgcatctttcagaaacttctagt
gactcctcagtggaggaatccaagggcagagatttaggcaagagcaaaaggaggaaaaac
atgtctgcaacagagacagaagacctcaaagagaaaaaggggtgcagtagctcaagtggt
gaggatgaagacctgggaaatgtagtcatggtgactgccaaacctgtgtttgaaggcaga
aaaaagagattgcggagcaagagaggaataagaaataaaatgtcctaa

DBGET integrated database retrieval system