KEGG   Corvus cornix (hooded crow): 104686451Help
Entry
104686451         CDS       T03546                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00010  Glycolysis / Gluconeogenesis
ccw00030  Pentose phosphate pathway
ccw00051  Fructose and mannose metabolism
ccw00052  Galactose metabolism
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
ccw01230  Biosynthesis of amino acids
ccw03018  RNA degradation
Module
ccw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104686451 (PFKP)
   00030 Pentose phosphate pathway
    104686451 (PFKP)
   00051 Fructose and mannose metabolism
    104686451 (PFKP)
   00052 Galactose metabolism
    104686451 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104686451 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccw01009]
    104686451 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccw03019]
    104686451 (PFKP)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104686451 (PFKP)
Protein phosphatases and associated proteins [BR:ccw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104686451 (PFKP)
Messenger RNA biogenesis [BR:ccw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104686451 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 104686451
NCBI-ProteinID: XP_010393182
LinkDB All DBs
Position
Unknown
AA seq 756 aa AA seqDB search
MNAAVRAVVRMGIYVNAKVYFIYEGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARC
KPFRTREGRLQAAFNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQKGKIDAEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKRLNIIIVAEGAIDC
HNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
DTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFLEAVRLRGRSFENNLNTYKLLS
HKKPDSELPKTNFNVAVLNVGAPAAGMNAAVRAAVRVGMTEGHKIFAVIDGFEGFARGKI
KEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAFESCLQL
YEARSSFEEFKVPMCVLPATISNNVPGTDYSIGADTALNAIVETCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGALAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWIS
KKLKETYRKEEGKVFANTDDSVCLLGMRRRNLVFQPVAELKSETDFIHRIPKEQWWLKLR
PLMKILAKYKTSYDVSDSGQLEHVAMLPKEAETGAI
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgtgcgcgcagtagtacgcatgggaatctatgtaaatgccaaagtctat
tttatttatgagggttaccagggaatggttgatggaggtgataatattgtagaagtttca
tgggaaagtgtttcaagtatcctgcaagtgggaggcacagtcatcggcagcgcgcgctgc
aaacccttccgcacgcgcgagggccgcctgcaggccgccttcaacctggtgcagagaggg
atcaccaacctctgcgtgatcggcggcgacggcagcttaaccggcgccaacctcttccgg
gaggaatggagcgggctgctggaagagctggcacagaagggaaagattgatgcggaggct
gttaagaaatatgcttaccttaacattgtgggaatggttggatccatagacaatgacttc
tgtggcactgatatgaccataggtactgactcagctctgcacagaataattgaagttgtg
gatgccatcatgaccactgctcagagccatcagaggacatttgttctggaggttatgggg
cgacactgtgggtatctagctctggttagtgccttagcctgtggtgcagattgggtgttt
attcctgaatacccaccagaagaaggctgggaggattcaatgtgtgttaagctttcagag
aatcgtgcacgaaagaaaaggctgaatattattattgtagctgaaggagctattgattgt
cacaacaaacctataacatcagagaaggttaaggatcttgtggttcagcggcttggtttt
gacacccgagtaaccatcctgggtcacgtgcaaagaggtggaaccccttcagcttttgac
agaattcttgcgagtcgtatgggtgtggaagccgtgcttgcccttctagaagctactcca
gatacccctgcctgtgttgtgtccctgtctggaaaccaggctgtccgtctgcctctgatg
gagtgcgtgcagatgactcaagaagtccagaaagccatggatgagggaagatttcttgag
gctgtgagacttcgtggaaggagctttgaaaacaacctcaacacgtacaaattactgtcg
cacaaaaagccagattctgagcttccaaagactaatttcaatgtggcagttttaaatgtt
ggtgcccctgcagctggaatgaatgctgccgtgagggctgcagtgagagttggcatgact
gaaggtcacaaaatatttgctgtcattgatggttttgaagggttcgctcgagggaagatc
aaggaaattagctggggagatgttggaggctggactggtcaaggaggatcaattcttggt
acaaaacgtactcttcctgcaaaatatttggagaagattgctgaccagatgcgcactaac
aacattaacgcccttatggttattggtggatttgaggcctttgaaagttgtctgcagctc
tacgaggctcgttccagctttgaggagtttaaagttcctatgtgtgtgttgcctgctact
attagcaacaatgtgccaggcacagactatagcattggtgctgacactgccttgaatgct
attgtggagacgtgtgaccgcatcaagcagtcggccagcggcaccaagcgccgcgtgttc
atcatcgagaccatgggcggctactgcggctacctggccaacatgggcgccctggcagca
ggagctgatgctgcttacatcttcgaagagcagtttgatatcagagagctccaggctaat
gtggaacacttgactgaaaaaatgaaaaccagtatccagcgtggtctagtgctgagaaat
gagaactgcaatgagaactacacaactgatttcatttatcagctgtattctgaagaagga
aaaggagtgtttgactgtcgaaaaaatgtattgggtcatatgcagcagggtggagcacct
tcaccgtttgatagaaattttgggacaaaaatttcagcaaaagctatgcagtggatctcc
aaaaaactgaaagaaacctaccggaaagaagaaggaaaagtatttgccaataccgatgac
tcagtctgtttgctgggaatgcggagacgcaacctcgtttttcaacccgtggctgagctc
aagagtgaaacagacttcatacacaggattcccaaggagcagtggtggctgaagctgcga
ccactgatgaagatcctggccaagtacaagaccagctacgatgtgtcagactcaggccag
ctggaacacgtggccatgctcccaaaggaggctgagactggagccatctaa

DBGET integrated database retrieval system