KEGG   Corvus cornix (hooded crow): 104688154Help
Entry
104688154         CDS       T03546                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00052  Galactose metabolism
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104688154 (SI)
   00500 Starch and sucrose metabolism
    104688154 (SI)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104688154 (SI)
    3.2.1.20  alpha-glucosidase
     104688154 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104688154
NCBI-ProteinID: XP_020440033
LinkDB All DBs
Position
Unknown
AA seq 1808 aa AA seqDB search
MGKKFSGLELTLIILFSVVVVILCVLIGLLATGQSGVKSPDFYPQCQEIPVAERINCIPD
QLATQSTCSLRGCCWSPQSDTSVPWCFFSPKHGYKVQGSQKSTQAGFEATLKRLPSPSLF
GNDIHTVLLTGEYQTPNRFRFKITDPNSQRFEVPHEHVRPFTGSAATGLNYKVELKQEPF
GIVVTRASNGKVLFDTTIGPLQYSDQFLQLSIKLPSSNIYGVGEHVHKQYRHDVNWKTWP
IFSRDTAPSAAMDNLYGAQTFFLCLEDDTGASFGVFLMNSNAMEFVVQPAPAVTYRTIGG
ILDFYIFLGNTPEQVVQEYLKLVGLPALPSYWSLGFQLSRYGYSSLDEVKEVVERNRAIG
LPYDTQVIDIDYMEERKDFTYDKVNFKNLPEFAAYLHDYGQKYVIILDPAISTQNLVDGS
SYGSYVRGTQRKVWINESDGVTALLGEVWPGETVFPDFTNPECTSWWVNECKLFHDTVPY
DGLWIDMNEVCNFVQGSKGGCAQNELNYPPYTPHILDRLLYSKTICMDAVQNWGKQYDVH
NLYGYSMILSSKKAIEEVFPGKRSFLISRSTFAGSGKHSGHWLGDNAATWDHLRWAIPGM
LEFNLFGIPYIGADICGFGGDTTEELCRRWMQVGAFYPFSRNHNAIDAISQDPAVFGANS
LLVNSSKHYLNIRYTLLPYLYTLLYKAHTQGHTVVRPLLHEFYSDEITWNIDRQFLWGPG
LLISPVLEPGVEYTRVYFPDAAWYEYDTGEPVLMRKLWHDLQTPKEKMGLHLRGGYIFPT
QQPGNTTVASRKNPMGLIIALDINNEASGDLFWDDGESTGTIENKAYIYYEFKVSNNVLQ
MTATHSNYTDPNNLKFEEIKILGLSQEVTAVSVSQDNVVQNYPLNITYDPVRKVAVIRGL
QLELGKSYTISWTLGVSTNERFDCYPNLDPTKEKCEQLGCTWEETPNSSVPACYYSSNNP
YSVMSLNYSSTGIVATLSLDSAKVRANENATAPISTLLLEVKYHLNNMLQFKISDSQSPR
YEVPVPLNLPSSPTSTSQDRLYEVAIQIKPFGIQIRRKSTGTVIWDSGLPTFTFSDMFIQ
ISTRLASQYIYGFGEAEHPTFRHNMNWHTWGMFTRDQPPTYKMNSYGYQPFYMALEEDGN
AHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTELVGRPVMPPY
WSLGFQLCRYGYANDSEIAQLVEEMKAAQIPYDVQYSDIDYMDRQTDFTISTHFAGLPAL
IDKIKAEGMRFIIILDPAISGNETDYPAFSRGVDNDVFIKRPDTNEILYSKVWSFLPNVQ
INESLPHETQVELYAAHSAFPDFFRNSTAEWWKKEILEVYSNPNASRSLKFDGLWIDMNE
PAAFVNGAVDGCRNDLLNNPPYMPRLGSRSAGLSYKTICMEAQQYLADGTPVRHYDVHNL
YGWSQTKPTLEALQNITKERGIVITRSTYPSSGRWSGHWLGDNTAAWDQLPKSVVGMLEF
SLFGISYTGADICGFFQDAEYEMCLRWMQLGAFYPFSRNHNGKGARRQDPAVWNATFHSI
SRDVLNIRYTLLPYLYTLMHDAHAHGSTVVRPLLHEFVEDRKTWDIDQQFLWGPALLISP
VMQPDARSVEAYFPNARWYDYYTEADTGFRGQLQTLQAPLDHINLHIRGGYILPWQIPAN
TTAYSRKNAMGLTVALDDALFAEGHLYWDDGVRIDAYEDGVYLLTSFTANQTVLDIRVIH
QNYTDPNNLMFTDIKVLGVPTSVQQVTVSQNGQAIPSSPDRVYESNKKLLTITKLQLQLG
QNYTLQWS
NT seq 5427 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagttcagtgggctggagctcaccctgatcatcctcttctccgtggtggta
gtgatcctctgtgtcctcattgggttgctggccacggggcaatccggagtgaaatctcca
gacttttacccacaatgtcaggagataccagtagcagagagaatcaactgcatcccggat
caattggcaacacagagcacctgctccctccgtggctgctgctggagcccccagagcgac
accagtgtgccctggtgcttcttctcccccaaacacggctacaaagtgcagggctcccag
aaatccacccaggcaggatttgaggccacgttgaaaaggctgccatccccttccctcttc
gggaacgacatccacacggtgctgctcacaggagagtatcagacacccaatcgcttccga
ttcaagatcactgaccccaactcacaaagattcgaggtccctcacgagcacgtgcggccg
ttcacggggtccgcggccaccggcctcaactacaaggtggagctgaagcaggaacccttc
ggcatcgtggtgaccagagcgagcaatggcaaagtgctgtttgacacaaccattggcccc
ctgcagtactctgaccagttcctgcagctctccatcaaactgcccagcagcaacatctac
ggcgtgggggagcacgtgcacaaacagtacaggcacgatgtcaactggaaaacctggcct
attttcagcagggacactgccccctctgcagcaatggataacttatatggagcccagact
ttcttcctgtgtttggaagatgacactggagcctcctttggtgttttcctgatgaacagc
aatgccatggagtttgtggtgcagcctgctccagctgtgacctacagaaccatcgggggc
atcctggatttctacatcttcctggggaacactccagagcaagtagtccaggagtacctg
aagctcgtgggactgccagcactgccctcctactggagcctgggattccagctcagccgc
tatggttacagctccctggatgaggtgaaggaagttgtggagaggaacagggccatcggg
ctgccctatgatacccaagtcattgacattgattatatggaggaaaggaaagattttact
tatgacaaagtgaacttcaaaaatctccctgaatttgcagcttatttgcatgactatgga
caaaaatatgtcatcatattggatcctgccattagcacccaaaatctggttgatggaagt
tcctatggaagctacgtcaggggaacgcagagaaaagtctggattaatgaatcagatgga
gtaacagcactgcttggggaggtgtggccaggggaaactgtgttcccagacttcaccaac
cctgaatgcacgagctggtgggtgaacgagtgcaaattgttccatgacactgtgccctat
gatgggctctggattgatatgaatgaagtgtgcaactttgttcaaggctcaaaaggtggt
tgtgcacagaatgagttaaactaccctccttacactccccatattcttgacagactcttg
tattccaagacaatttgcatggacgcagtgcagaactgggggaagcagtatgatgtccac
aatctttatggatattccatgatcttatccagtaaaaaagccattgaggaggtctttcct
ggaaagagaagcttcctcatttcgaggtctacttttgcgggatcgggaaagcactcagga
cactggctgggggataatgcagcaacgtgggatcacctgagatgggcaatccctggaatg
ctggagtttaacctctttggaattccttatattggagcagatatttgtggttttggtggc
gacaccacagaggaactttgcagacgatggatgcaggtgggagcattttacccattctcc
aggaaccacaatgctatagatgccatatctcaagatccagctgtatttggagccaactcc
ttgttggtgaacagctccaagcattacctgaacattcgctacactttgctgccctacctg
tacacgctgctctacaaagctcacacccaagggcacacggtcgtgaggccactgctacac
gagttctactctgatgaaataacatggaacatcgacaggcagttcctgtggggccctggg
ctgctgatttcccctgttcttgagccgggtgtggagtacactcgtgtgtactttcctgat
gcagcgtggtacgagtatgacacgggcgaaccagtccttatgaggaaattgtggcatgat
ttacaaaccccaaaggaaaaaatggggctgcacctgagaggaggatacattttccctact
cagcaaccaggcaacaccacagtggcaagccgcaagaatccaatgggactcataattgcc
ctggatatcaacaatgaagcttctggggatttgttctgggatgatggagaatctacaggt
acaattgagaataaagcctacatttactatgagtttaaagtttccaataatgttctacaa
atgactgctacacacagcaattacactgatccaaacaacctgaaatttgaggaaatcaag
attctgggattgtcccaggaagtgacagcagtttctgtgtctcaggacaatgttgtgcaa
aattatccccttaatatcacctatgatcctgtgagaaaggttgctgttataagaggactt
cagcttgaactgggaaaatcttacacaatcagctggactctcggtgtgagcaccaatgaa
aggtttgattgttatcccaacctcgatccaacaaaagaaaaatgtgaacaacttggctgt
acctgggaagagacaccaaattcgagtgttcctgcctgctattacagctccaacaatcct
tactctgtcatgagcctaaattattcctccactggaatcgtagccaccctcagcttggac
agtgccaaggtcagagctaacgagaatgccacggccccgatcagcaccctactcctggag
gtgaaatatcatctcaacaacatgctgcagttcaagatctctgattcccaaagcccacga
tatgaggttccagtgcccctgaacctgcccagctcccccacgagcacgagccaggaccgg
ctctatgaggtcgcaatccagatcaaaccctttgggatccaaatccgccgcaaaagcacg
gggacagtcatctgggattcaggcctgcccaccttcaccttcagcgacatgttcattcag
atttccacccgcttggcatcccagtacatctacggattcggagaagctgagcaccccacg
ttccgacacaacatgaactggcacacctggggaatgttcaccagggaccagcctccaact
tacaagatgaactcctatggttatcagccattttatatggctcttgaagaagatggcaat
gcccacggtgttctcttgcttaacagcaatgcgatggatgtgactttccagcccacccct
gccctgacctaccgcaccatcggaggaattctcgacttctacatggtcttgggcccaact
cctgaactcgtggttcaagaatacactgaactggttggccgcccagtcatgccaccctac
tggtccttgggattccagctgtgccgctacggatacgcgaacgactcggagatcgcccag
ctggtggaggaaatgaaggcagctcagattccctacgatgtccagtattcagatattgac
tacatggacaggcaaacggacttcaccattagcacacactttgctggattaccggctctg
atcgacaaaatcaaagcagaaggaatgagatttatcattatcctggatccagccatttct
gggaatgaaaccgattatcctgccttctccagaggcgtggacaatgatgtcttcataaaa
cggcctgataccaatgaaattttatattccaaggtctggtcatttcttcccaatgtccaa
atcaacgagtcactacctcatgaaacacaagtagagctctacgcagcacattctgctttc
ccagacttcttccgcaattccacggcggagtggtggaagaaggaaattctggaggtctac
agcaaccccaacgcctcaagaagcctcaagtttgatggcctgtggattgacatgaatgaa
ccagcagcttttgtgaatggtgccgtggatggctgtaggaatgacctcctaaataatcct
ccctacatgcctcgtttgggatccaggtcggcaggattatcctacaaaaccatatgcatg
gaagctcaacaatacctcgcagatgggaccccagtcagacactacgatgtccacaacctt
tatggatggtcccaaaccaaacccacgctggaggctttgcagaacatcaccaaggagcgc
gggatcgtcatcacccggtccacgtaccccagcagcgggcggtggtcagggcactggctg
ggggacaatacggcagcctgggatcagctgcccaaatctgtggttggcatgctggagttc
agtctctttggaatatcttatacaggagctgatatctgtggcttcttccaagacgcagag
tatgagatgtgcctccgctggatgcagctgggtgcattttacccattttcgaggaatcac
aatgggaaaggagcaaggaggcaagatcctgctgtctggaatgccacattccacagcatt
tccagggacgtgctgaacatcagatacaccctgttgccttatctctacaccttaatgcat
gacgcccacgcccacggcagcaccgtggtccgcccccttctccacgagtttgtggaggac
agaaaaacgtgggatatcgaccagcagttcctctggggtcctgccctgctcatcagcccc
gtgatgcaaccagatgctcgaagtgtggaggcttatttccccaatgcccgctggtatgat
tactacacagaggcagatactggctttaggggacagctccaaactttacaagctcctttg
gatcatatcaacctgcatatccgaggtggatacatcctgccttggcagatacctgctaat
acaactgcttacagccggaagaacgcgatgggactcacggtggccctggatgatgctctg
tttgcagaaggacacctttattgggatgatggggttcgcattgatgcatatgaagatggt
gtttacctgctaacatcatttactgctaatcagactgttttggatatcagagttatacat
cagaattacactgatccaaacaacctgatgtttactgacatcaaagtcctgggggtgccc
accagtgtccagcaggtgacagtgtctcagaatgggcaggcaatcccatcatcccccgac
agggtctatgagagcaacaagaagctcctgacaatcaccaagctccagctgcaactgggc
cagaactacaccctgcaatggagctga

DBGET integrated database retrieval system