KEGG   Corvus cornix (hooded crow): 104688375Help
Entry
104688375         CDS       T03546                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00590  Arachidonic acid metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104688375 (PTGS1)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104688375 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 104688375
NCBI-ProteinID: XP_010396161
LinkDB All DBs
Position
Unknown
AA seq 579 aa AA seqDB search
MVMSPSLSLPAVNPCCYFPCQNQGVCVRVGLKGYECDCTRTGYYGVNCTSPEFWTHLHNL
LKPSPAFYHFILTHFRWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYISWEA
YANVSYYTRILPPVPDDCPTPMGTKGKLQLPDPQLLAERFLLRQKFEADPRGTNMMFAFF
AQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEV
YPPMVTDAPVHMVYPSGVPKEQQLAVGQEVFGLLPGLCVYATLWLREHNRVCDLLKRDHP
TWSDEQLFQTARLILIGETIKIVVEDYVQHLSGYYLSLKFDPELLFGSQFQYRNRIAVEF
NQLYHWHGLMPDSFIIQGQQYSYKQFLYNTSMLMDYGVEALVESFSKQIAGRIGGGQTIN
ANVLHVAVGVIKESRQLRLQPFNEYRKRFGMKPYKSFQELTGEEEKAAELEELYGDIDAL
EFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGATGFEIVKT
ASLEKLVCLNVKKCPYVAFRVPDAAEHGRPRAGGSSTEL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgtctccctctctctccctccctgcagtgaatccctgttgctatttcccctgc
cagaatcaaggggtgtgtgtgagggttggcctgaaaggatacgagtgtgactgcacacgg
acgggatactatggggtcaactgcacctcccctgagttctggacacatctccacaacctg
ctgaagcccagtcctgccttctaccacttcatcctgacccacttcaggtggttttgggac
attatcaacagcaccttcatcagggacacactcatgaggctcgtcctaacagttcgtgcc
aatctcatccccagcccccccactttcaactctgactatggctacatcagctgggaggcc
tatgccaacgtcagctactacacccgcatcctcccgcccgtgccggacgactgccccacg
cccatggggaccaaagggaagctgcagctccccgacccccagctcctggcggagaggttc
ctgctgcggcagaagttcgaagctgatccccgaggcaccaacatgatgtttgccttcttt
gctcagcatttcacccaccagttcttcaagacatcggggaagatgggacgcggcttcacc
aaggcgctggggcacggggtggacctgggacacttgtacggggacaacctgcagcggcag
caccagctgcgactcttccgagatgggaagctgaaattccaggtggtggatggagaggtg
tacccgcccatggtcaccgatgctcctgttcacatggtgtacccgtcgggcgtgcccaag
gagcagcagctggcggtggggcaggaggtgtttgggctgctgccagggctctgcgtgtac
gccacgctctggctgcgcgagcacaaccgtgtctgcgacctgctcaagagggaccatccc
acctggagtgacgagcagctcttccagacggcgcggctcatcctcatcggggagaccatt
aagatagttgttgaagactacgtccagcacctcagtgggtactacctgagcctcaagttc
gaccccgagctgttgtttgggtcacagttccagtaccggaatcgcatcgcggtggagttc
aaccagctctatcactggcacgggctgatgcccgactccttcatcatccagggtcaacag
tacagctacaagcagttcctctacaacacctccatgctcatggactacggcgtggaggcg
ctggtggagtccttttccaagcaaatagcaggaaggatcggtgggggacagaccatcaac
gccaatgtcttgcatgtggccgttggggtcataaaggaatcccggcagctgaggctacag
cccttcaatgagtatcggaaaaggtttggcatgaagccctacaagtccttccaggagctg
acaggagaggaagagaaggcggcagagctggaagagctgtatggagacattgatgctctg
gagttttacccaggattgctgctcgagaaaccacaacccaatggcatttttggggaaagc
atggtggagattggagctccattttccctgaaggggctttttggcaatcccatctgctcc
ccagagtactggaaacccagtacatttggtggagcaaccggctttgagattgttaagacg
gcatccctcgagaagctcgtgtgcctcaacgtgaagaagtgcccgtacgtggcgttccgt
gtgccggacgctgcggaacacggccgccctcgggctggtggatcatctactgagctctag

DBGET integrated database retrieval system