KEGG   Corvus cornix (hooded crow): 104688675Help
Entry
104688675         CDS       T03546                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00010  Glycolysis / Gluconeogenesis
ccw00053  Ascorbate and aldarate metabolism
ccw00071  Fatty acid degradation
ccw00280  Valine, leucine and isoleucine degradation
ccw00310  Lysine degradation
ccw00330  Arginine and proline metabolism
ccw00340  Histidine metabolism
ccw00380  Tryptophan metabolism
ccw00410  beta-Alanine metabolism
ccw00561  Glycerolipid metabolism
ccw00620  Pyruvate metabolism
ccw01100  Metabolic pathways
Module
ccw_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104688675 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    104688675 (ALDH2)
   00620 Pyruvate metabolism
    104688675 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104688675 (ALDH2)
   00561 Glycerolipid metabolism
    104688675 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104688675 (ALDH2)
   00310 Lysine degradation
    104688675 (ALDH2)
   00330 Arginine and proline metabolism
    104688675 (ALDH2)
   00340 Histidine metabolism
    104688675 (ALDH2)
   00380 Tryptophan metabolism
    104688675 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104688675 (ALDH2)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104688675 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 104688675
NCBI-ProteinID: XP_010396616
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MLRAVVRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAYNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISAGQREGAKLLCGGNAAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQILKFKTIEEVIERANDSKYGLAAAVFTKDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtggtgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgctgcctcccccatcccggcgcccaacccgcgccccgacatcgcctataac
aagattttcataaataacgaatggcacgatgcagtcagcaagaaaaccttcccttccatc
aacccagccacaggagaagtcatctgccaggtggctgagggtgataaggcagatgtggac
aaagccgtcaaggcagccaaggcagcattccagctgggctctccctggaggaggatggac
gcatctcaccggggcaagctgctgaaccgtctggctgacctgatcgagagggaccgtgcc
tacctggctgcactggaaactctggataacggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcagataaattccat
ggcaaaaccatcccattagatggagacttcttctgctacacaagacacgagccagtggga
gtttgtggacagatcatcccgtggaacttcccactgttgatgcaagcctggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaagtggcagagcaaacccccctgagc
gctctctacgtggccaatctgatcaaagaggctggattccctccgggcgtggtgaacatc
atccctggctatgggcccacggcaggagctgccatctcctcccacatggacattgataag
gtggccttcaccggctccacagaggttggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatataatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaaggacag
tgctgctgtgctgggtccaggacatacgtgcaggaggatatttacaatgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttggaaacccctttgacttcaaaactgag
caggggcctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcgctggg
cagcgggagggagccaagctgctgtgtggtggcaacgccgctgcagacaggggctacttc
atccagcccacagtctttggggacgtgcaggacaacatgaccattgccagggaggagata
tttgggccagtcatgcagatcctgaaattcaaaaccattgaggaggtcattgagagagcc
aacgactccaagtatggcctggcagccgcagtgttcaccaaggacctggacaaagccaac
tttgtgtcacagagcctgcgggctgggacagtctggataaactgctatgatgtgtttggt
gcccaggccccctttggtggctacaaagcctcagggaacgggcgggagctgggagagtac
ggcctggaggcctatgtggaggtgaaaaacgtgacaatcaaaatcccacagaaaaactcc
taa

DBGET integrated database retrieval system