KEGG   Corvus cornix (hooded crow): 104690144Help
Entry
104690144         CDS       T03546                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00010  Glycolysis / Gluconeogenesis
ccw00051  Fructose and mannose metabolism
ccw00052  Galactose metabolism
ccw00500  Starch and sucrose metabolism
ccw00520  Amino sugar and nucleotide sugar metabolism
ccw00524  Neomycin, kanamycin and gentamicin biosynthesis
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
ccw04910  Insulin signaling pathway
Module
ccw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104690144 (HK1)
   00051 Fructose and mannose metabolism
    104690144 (HK1)
   00052 Galactose metabolism
    104690144 (HK1)
   00500 Starch and sucrose metabolism
    104690144 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    104690144 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104690144 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    104690144 (HK1)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104690144 (HK1)
Membrane trafficking [BR:ccw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104690144 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 104690144
NCBI-ProteinID: XP_010399013
LinkDB All DBs
Position
Unknown
AA seq 889 aa AA seqDB search
MRLSDETLLDVMARFRREMKNGLSRDFNPTAVVKMLPTFVRSIPDGSEKGDFIALDLGGS
YFRILRVKVSHEKKQTVQMESEIYNTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKL
PVGFTFSFPCRQSKLDEGILITWTKRFKASGVEGADVVRLLNKAIKKRGDYDADIMAVVN
DTVGTMMTCGFDDQRCEVGLIIGTGTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDG
SLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPEL
LTKGKFETKHVSAIEKSKEGLNKAKEILTRLGVEPSHEDCIAVQHVCTIVSFRSANLVAS
TLGAILNQLRDNKGVGRLRTTVGVDGSLYKMHPQYARRLHKTTRRLVPDSEVRFLLSESG
SGKGAAMVTAVAYRLSEQHRLIDETLAEFKLTHEQLLQVKKRMRAEMEAGLKKKTHETAK
VKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQ
GTGEELFDHIVTCISDFLDYMGIKGARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDC
EGEDVVYLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYME
EMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDDIRTIYDKAVDDFSLNAGKQRYEKMISGM
YLGEIVRNILIDFTKRGFLFRGQISETLKTRHIFETKFLSQIESDRLALLQVRTILQQLG
LNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAAIVDKIRENRGLEHLEITVGVDGTLYKLH
PHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKGAALITAVGCRLREAEQN
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgaggctctctgatgaaacactgttggacgttatggctcgcttcaggagagagatgaag
aacggcctctccagggattttaacccaacagccgtagtgaagatgcttcccacgtttgtg
aggtccattcctgatggttcagagaaaggagatttcattgcactggaccttggtggttct
tacttccgaattcttcgggtaaaggtatcgcatgaaaaaaagcagacggtgcagatggaa
agtgaaatttataataccccagaagacatcatgcacgggagtggaacacggctttttgat
catgttgctgaatgcctgggagactttatggagaaacaacaaatcaaagacaagaaactg
ccagttgggtttacattttccttcccttgtcgacaatctaagttagatgagggtattctg
ataacctggacaaagcgcttcaaagcgagcggagtggagggagcagatgtcgtgaggctg
cttaacaaggccatcaagaaacgtggggactatgatgcggatatcatggctgttgtgaac
gacactgtcgggaccatgatgacctgtggctttgatgaccagcgctgtgaagttggcttg
atcattggcactggcaccaatgcctgttacatggaggagatgcggcacatcgacctggtg
gaaggggatgagggcaggatgtgcattaacacggagtggggggcctttggagatgatggc
tcgctggaagacatcaggaccgagtttgatcgagagatcgaccgtggatcccttaatcct
gggaagcagctgtttgagaagatggtcagtgggctatacatgggggagcttgtaaggctc
atcctggtgaagatggccaaggaggggctgctctttgaggggagaatcacccctgagctt
ctcaccaaagggaagtttgagacgaagcatgtttctgccattgaaaagagcaaagaaggt
ttgaacaaagccaaagaaatcctgacccggctgggggtggagccgtcccacgaggactgc
atcgctgtccagcacgtctgcaccattgtgtccttccgctcagccaacctggtggcctcc
accctgggtgccatcctcaaccagctgcgggataacaagggggtcggccgcctccggacc
accgtgggggtggatgggtccctctacaagatgcatccacagtacgcccggcgcttgcac
aaaaccacgcggcgcctggtgcctgactcggaggtgcggttcctgctgtcggagagcggc
agcgggaagggagcggccatggtgacggccgtggcgtaccggctgtcggagcagcaccgc
ctcatcgacgagaccctggctgagttcaagctcacccacgagcagctgctgcaggtgaag
aagagaatgagggcggagatggaagcggggctgaagaagaagactcacgagactgccaaa
gtgaagatgctgcccaccttcgtccgcagcacgccggatgggacagagaatggagacttt
ctggcacttgaccttggagggacaaacttcagagttttgctggtgaaaatccgcagcggt
aaaaggagaacagttgagatgcacaacaagatctatgccattcccatagaggtgatgcag
ggaacaggagaagagctgtttgatcacatcgttacctgcatttctgacttcctggattat
atggggataaaaggcgcacgtcttcctcttggcttcaccttttccttcccttgcaagcag
accagtctggatgctggtatccttctcaattggacaaaaggcttcaaagctacagactgt
gagggagaagatgtggtatatttgcttagagaaggaattaaaagaagagaggaatttgac
ttggatgtggtggctgtggtgaatgatacagtgggcacaatgatgacttgtgcttatgaa
gatccaaactgtgagattggactcattgtgggaacgggcagcaatgcttgttacatggaa
gagatgagaaacatagagatggtggatggtgagcaagggcggatgtgtgtgaacacggag
tggggagcgttcggggataacgggtgcctggacgacatcaggacaatatatgacaaagca
gttgatgacttctcactgaatgctggaaagcaaaggtatgagaaaatgatcagtgggatg
tacctgggggaaatagtccgcaacattttgatcgacttcaccaaacggggtttcctgttc
cgaggccagatttcagagacactgaagaccagacatatctttgaaaccaagttcctttct
cagattgagagtgacaggttagccttgctgcaggtgcgaaccatcctccagcagctgggg
ctcaacagcacctgtgatgacagtatcattgtcaagacagtctgcggagcagtgtcaagg
cgagcagctcagctgtgtggtgctggaatggctgccatcgtagataaaatcagggagaac
agagggttagagcacctggagataacggttggtgtggatggcaccctgtacaaactacac
ccacacttttcgaggatcatgcaccaaacagtcaaagacctggcacccaactgcgacgtg
accttcctgctgtcggaggacggcagcgggaaaggggcagcgctcatcacagcggtggga
tgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system