KEGG   Corvus cornix (hooded crow): 104690199Help
Entry
104690199         CDS       T03546                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00020  Citrate cycle (TCA cycle)
ccw00310  Lysine degradation
ccw00380  Tryptophan metabolism
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104690199 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    104690199 (OGDHL)
   00380 Tryptophan metabolism
    104690199 (OGDHL)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     104690199 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 104690199
NCBI-ProteinID: XP_020439467
LinkDB All DBs
Position
Unknown
AA seq 1014 aa AA seqDB search
MSHLKLFAATLRRHGFKLLEKQDIARRAFLHGQRYVSSGTSEPFLSGSNSNYVEEMYYAW
LENPKSVHKSWDVFFRSANAGQMRDPHLPAQLEGKASFLQSHGLAPTPGKAEKVVEDHLA
VQSLIRAYQIRGHHVAQLDPLGILDADLDSFIPSDLITTIDKLGFYGLHESDLDKVFQLP
TTTFIGGNENSLSLREIIKRLEYTYCQHIGLEYMFINDVEQCQWIRQKFETPGVMKFTNE
EKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGM
PHRGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNKKITLS
LMANPSHLEAVDPVVQGKTKAEQFYRGDTAGKKVMSILLHGDAAFAGQGVVYETFHLSDL
PSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSV
AAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGT
VTLQEFEEEIAKYDRICEEAYTRSKDNKILHIKHWLDSPWPGFFNMDGEPKSMSCPPTGI
SEELLTHIGNVASSVPVEDFKIHSGLSRILKARSEMTKNRVVDWALAEYMAFGSVLKEGI
HVRLSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFE
LGFAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPE
HSSARPERFLQMSNDDSDAYPEFSEQFEVSQLYECNWIVVNCSTPANYFHVLRRQILLPF
RKPLIVLTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGLAAQAPHEVKRVIFCTGKVYY
DLVKERKNQDLEKQVAITRLEQISPFPFDLLKEELDKYPTADLVWCQEEHKNSGYYDYVK
PRFRTIVNHTRPIWYVGREPAAAAATGNKNMHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcagctacgctgaggaggcatggctttaaacttctggaa
aagcaggatatagccagaagggcatttttacatggccaacggtatgtttcatcaggaacc
tcagagccattcctgagtgggagtaattccaattatgtggaggaaatgtactatgcatgg
cttgaaaaccctaaaagtgtacataagtcctgggatgtgtttttccgaagtgctaatgct
ggccaaatgcgtgatccccatctaccagctcagctggaaggaaaggcatcatttctgcag
agccacggcctggccccgacaccggggaaagctgaaaaggttgttgaggaccaccttgct
gtgcagtcattgataagagcataccaaatccgtggccatcatgtggctcagctagatccc
cttggaattctggatgcagatttggattcgtttattccatctgaccttattaccacaatt
gataaacttggattttatggtttgcatgaatcagatttggacaaagtctttcagctgcca
acaaccaccttcataggaggaaacgagaacagtctttctttacgagagatcatcaaacgc
ctggagtatacctactgccaacacattggcctggagtatatgttcatcaatgatgtggag
cagtgccagtggatccgtcagaagtttgagacgccgggagttatgaagttcacaaacgag
gaaaaaaggactttgctggcgaggctggtgcgctccatgagatttgaggacttccttgct
cgcaagtggtcttccgaaaagagatttggtttggaaggatgtgaagtaatgattcctgca
cttaagaccatcattgataaatccagtgaaatgggaattgaatatgttataatgggaatg
cctcatagaggtcggctgaatgtattggctaatgtaatccgaaaagagctggagcagatc
ttctgtcagtttgatcccaaacttgaagcagctgatgagggatccggggatgtgaaatat
catctgggaatgtaccatgagaggatcaaccgagtaacaaacaagaaaatcactctgtcc
ctgatggctaacccttctcacttggaagcagttgatcctgttgtgcaagggaaaacaaaa
gctgagcagttttatcgaggggatacggcagggaaaaaggttatgtccatattattacat
ggggatgctgcctttgcaggacaaggagtggtttatgagacatttcatcttagtgacctc
ccatcctacaccacaaatggcactattcatgttgtggtcaacaaccagattggcttcacc
acagacccccgtatggcccgttcatccccatatcccactgatgttgctcgtgtggtcaat
gctcccattttccatgtgaatgctgatgaccctgaagcagtgatgtacgtgtgcagcgta
gctgcggagtggcgaaacactttcaataaagatgtggtcgttgacttggtttgttaccgt
aggagagggcacaatgaaatggatgagcccatgttcacccagcctctgatgtacaagcag
atccataagcaggtgccggtgctgaagaagtacgctgacaaactgattgcagatggaact
gtgacactgcaggagtttgaggaagaaattgcaaagtatgatagaatatgtgaagaagca
tatactagatctaaggataataagatccttcacatcaagcactggcttgattcaccttgg
cctggcttctttaacatggatggagaacccaagagcatgtcttgtcctccgacgggcatt
tcggaggagctgctgactcacattggcaacgttgctagttcagtgccagttgaagacttc
aaaatacactcaggactctcccggattttgaaagcccgctcggaaatgaccaagaacagg
gttgttgactgggccttagcagaatacatggcttttggctctgttctcaaagaagggatc
catgtccgactaagtgggcaggatgtggagagaggtactttcagccatcgtcaccatgtg
cttcatgatcaagaagttgacaagagaacttgtgttcccatgaatcacctctgggagcag
caggccccctataccgtgtgcaacagctccctttccgagtacggggtcttgggttttgaa
cttggctttgctatggcgagtcccaatgccctggtgtgctgggaagcccagtttggggac
tttcacaacacggctcagtgtataatagaccagttcatcagctccggccaggccaagtgg
gttcggcacaacgggatcgtcctgctcctgccacacgggatggaaggaatgggtccagag
cattcatcagccaggcctgagaggttcctgcagatgagcaatgacgattctgatgcctat
ccagagttcagtgagcagtttgaagtttcccagctgtatgaatgcaactggattgtggtg
aattgttcaactccagccaattacttccatgtcctccgacggcagatcttgctgccattc
agaaagccgctgattgttttgacacccaagtcactgctgaggcacccagaagctaaatcc
agttttgatgaaatggtgtctggtaccactttccaacgtgtgattcctgagaatgggctg
gcagctcaggcaccacatgaggtcaagcgagtgattttctgcacaggaaaagtgtactat
gaccttgtgaaagagaggaagaaccaggacctggagaaacaagtagctataaccagactt
gaacagatctcaccattcccctttgacttgctaaaagaagaacttgataagtatccaact
gctgatctagtttggtgtcaggaggagcacaaaaacagtggctattacgattatgtcaaa
cctcgtttccgcactattgtgaaccacactcgacctatctggtatgttggccgagagcct
gctgctgcagctgccacaggcaacaagaacatgcatctggtgtcactccgaagattcttg
gatacagctttcaacctggaggcctttgagggaaagacattctaa

DBGET integrated database retrieval system