KEGG   Corvus cornix (hooded crow): 104690262Help
Entry
104690262         CDS       T03546                                 

Definition
(RefSeq) homeobox protein NANOG-like
  KO
K10164  homeobox protein Nanog
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccw03000]
    104690262
Transcription factors [BR:ccw03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    104690262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Homeobox_KN Antimicrobial21
Motif
Other DBs
NCBI-GeneID: 104690262
NCBI-ProteinID: XP_010399253
LinkDB All DBs
Position
Unknown
AA seq 302 aa AA seqDB search
MCAHLALPPYQAHPGGAGMGYLEFYWNSAGEAGQAPTAAGPAGAAGARQSPEAGGRRHEA
EVSPPSSSSGNFSQFTPDSATSPHSSSSSPQPTAKSQKGRENGMEGLRKTKSRTAFSKEQ
LQTLHQRFQSQKYLSPQQIRELAVALGLTYKQVKTWFQNRRMKLKRCQKHSLWSERAQCL
TQSGFQTSTYLDVHPKFHQGYPITAAGNIQTMPAPRQHYGAGQNAYTIVTGEDGGVFGKG
GGTCSVQQTVGFIAQHKVDFYHSCPGSVEYPASKTGDGCNFHHSATMGAPFPTTASHHLY
HS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcgcacctggcgctgcccccgtaccaggcgcaccccggcggggctggcatgggg
tacctggagttttactggaactcggcgggggaggccggacaagcccccacggcggccggg
cctgcgggagccgccggggctaggcagtctccggaggcaggagggaggaggcacgaagca
gaagtatccccaccttcatccagttctgggaatttcagccaattcacaccagattcagcc
accagtccacattcatcatcctcgtccccacaacctacagctaagtctcagaagggcaga
gaaaatggcatggaggggctgaggaagaccaagagccgtacagctttctccaaggagcag
ctgcaaaccctgcaccagcgcttccagagccagaagtacctcagtccccagcagatccgg
gagctggctgttgccctggggctcacctacaagcaggtgaagacttggttccagaaccgg
aggatgaagctgaagaggtgccagaagcacagcctgtggagtgaacgggctcagtgcctc
acgcaaagtggcttccagaccagtacctacctggatgtgcaccccaaattccaccagggc
taccccatcactgcagctggcaacatccaaaccatgcctgccccccgtcagcactatgga
gcagggcagaatgcttacacaattgtgaccggcgaggatggaggagtctttggcaaaggc
ggggggacctgcagtgtccagcagacagtgggcttcattgcccagcacaaagtagacttt
taccacagctgtcctggcagtgtggaatatccagcctcaaagacaggtgatggctgtaat
tttcaccactcagccacaatgggggctcctttcccaaccactgccagccatcatctttat
cactcctaa

DBGET integrated database retrieval system