KEGG   Corvus cornix (hooded crow): 104690630
Entry
104690630         CDS       T03546                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04020  Calcium signaling pathway
ccw04144  Endocytosis
ccw04510  Focal adhesion
ccw04540  Gap junction
ccw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104690630 (PDGFRA)
   04020 Calcium signaling pathway
    104690630 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104690630 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104690630 (PDGFRA)
   04540 Gap junction
    104690630 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104690630 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccw01001]
    104690630 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccw04090]
    104690630 (PDGFRA)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104690630 (PDGFRA)
Protein kinases [BR:ccw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104690630 (PDGFRA)
CD molecules [BR:ccw04090]
 Proteins
  104690630 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 104690630
NCBI-ProteinID: XP_010399974
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPWTFLILGCFLTGPFITFCQLPLPTIVPNRNEMVVQLHSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPDAQVTLVNSLDKSVYALYDTKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMTESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccatggacgttcctgatcctgggatgttttctcacaggaccattcata
acattttgccagcttcctctgccaactattgttcccaataggaatgaaatggtggtacag
ctgcattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgaccgagggaaaccacaggatagatattagacacgaagaaaacaacagtggcctcttc
gtgacagtgctggaagtaggaaatgcatcggcggctcatacaggcttgtatgtttgctat
tataaccacacacaagtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgatccagacatgccttttgttccttctataccagaagaccagttcatcttagtagaa
gaaggtgatcccacagtaatcccttgtcggacaagtgacccagatgctcaagtgacttta
gttaacagtttagacaagtctgtgtatgctttatatgacaccaaacaaggcttcataggg
aattttcctgcaggctcatacacatgcaaaacaatggttaaaggtgtggagttcaagtct
gatgagttcctcatctatattataagagctacttcacagctgcctgttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggagattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggctttgttcacctggagcctcag
tttagccctctagaagctgtcaaccttcatgaagtcaaaaactttgttgttgatgtgcag
gcttacccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acagagattgttactagttccaacagagtccaggaaacaaggtttcagagtattttaaaa
ttgatacgggccaaggaggaagacagtggatactacactttggttgctgaaaatgaagat
gagattaaaagatacaccttctcattgctaatacaagttccagctctgatctcagccctt
gtggatgatcaccatggctctgcaggtgggcagacagtgagatgcttggcagaggggacc
ccacttcccgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatggactcttttgactaacaatatctctgatattcacatggaagcccacctggatgag
aaaaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggcggtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgagaactgaagcttgtggctcccacc
ttgagatcagagctaacggtggctgctgctgtcttagtgctgttagtgatcgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccgaggtatgagattagatggaga
gtcattgagtctatcagccctgatggccatgagtatatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcggatccttggt
tcgggtgcatttggaaaagtagttgaagggactgcatatggactgagtcgctctcagcca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtaaatctg
cttggagcttgtacgaaatcaggtcctatttacatcattactgaatactgtttttatggt
gatctggtgaactacttgcataagaacagggacaacttcctgaaccgacacccagaaaag
ccaaaaaaagatttggatatctttgggatgaaccctgctgatgaaagcacaagaagttac
gtgatattatcgtttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggagaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcgtataaaaagaaatccatgacagaatcagaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggcc
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagcactttcctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacattaagtgatgtctggtct
tacggcattctgctgtgggaaatattttctcttggtggcacaccgtatcctggcatgatg
gtcgattccactttctacaataagatcaagagtggataccgaatggccaaacccgatcat
gctaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaagaga
ccttctttctaccatttgagtgaaattgtggagagtttattgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggattgtgacaatgcttacattggtgtaacctacaagaacgaagacaagctaaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaagaaacagacacagttca
cagacatctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system