KEGG   Corvus cornix (hooded crow): 104690967
Entry
104690967         CDS       T03546                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00220  Arginine biosynthesis
ccw00330  Arginine and proline metabolism
ccw01100  Metabolic pathways
ccw04020  Calcium signaling pathway
ccw04146  Peroxisome
ccw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    104690967 (NOS2)
   00330 Arginine and proline metabolism
    104690967 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104690967 (NOS2)
   04020 Calcium signaling pathway
    104690967 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104690967 (NOS2)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     104690967 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 104690967
NCBI-ProteinID: XP_010400579
LinkDB
Position
Unknown
AA seq 1147 aa
MLCPWQFVFKPRAAKSQYPREKDINNNVEKNRKIHGSEKEDAKLYGPSKKQMERLPIVTS
AKASEGGENLPPNDIKVSNQISGCPRHVKVRNLENGSSFLDTLHLTAKEVINCRTKACQG
SLMTPKGLVRGTRDGPVPLEDLLPQAIDFLKQYYSSFKEPKIKEQLSRLETVTKEIEATG
TYHLTKDELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIQYATNN
GNIRSAITVFPQRTDGQHDFRVWNSQLIRYAGYQMPDGSVLGDPASVEFTQLCIELGWKP
KYGRFDVLPLVLQANGQDPEIFDLPPEIVLQVPMEHPKYEWFKELNLKWYALPAVANMLL
EVGGLEFTACPFNGWYMGTEIGVRDFCDAQRYNIMKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRARGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPKKKEIKFSILAKAVLFASSLMRGAVATRA
KVTVIYATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLEKETLLLVVTSTFGNGD
SPGNGKTFKDSLLRLKLLGKKIRYSVFGLGSSMYPEFCAFAHAIDQKLAQLGAAQLAPVG
EGDELNGQEEAFRSWAVSAFKTACDIFNIRGRHSIQLPDIYTSEESWDPTNYRLVHDSQP
MDLTKALASIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLYCETNQEVHYLPGEHIGIFP
GNQPELVHGIIARVKDAPPADQTIRLETCIDGGYWTSHKKIPACTLPEALTYLLDITTPP
SQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLL
TQLPLLKPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGEGPLHHGVCSTWLNTIELNETV
PCFIRSANEFHLPEEPAKPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGGDMTLLFGCR
QPDLDHIYREETEEMQRKGVLKDLYTAYSRLPGQEKVYVQDILQRQLEARVCEVVHGQQG
HVYVCGDVRMARDVARALRALLARALRLSPQQADEYFLQLKSQKRYHEDIFGAVFPHEVK
RALQPTS
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgctgtgcccgtggcagtttgtgttcaaacctcgtgctgccaagagccagtaccccaga
gagaaggatatcaacaacaacgtggagaaaaataggaagatccatggctcagaaaaggag
gatgccaaattgtacggtccaagcaagaagcagatggagaggctgcccatcgtaacttcg
gcaaaggccagtgagggaggagagaatctccctccaaatgacatcaaagtttcaaaccaa
atatcaggatgtccaagacatgtaaaagtaagaaacttggaaaatggatccagctttctt
gacacactacatctgactgcaaaagaggttatcaactgccggaccaaagcctgccaaggg
tcactcatgaccccaaagggcctggtgagaggtaccagagatgggccagttccactggaa
gatcttttacctcaggcaatagacttcctcaagcaatactacagttcatttaaagagcca
aaaatcaaagaacagctgagccgactggaaacagtgaccaaggagatagaagcaacagga
acctaccacctgacaaaggatgagctgacctttgctgccaagcaggcctggaggaacgcg
cccaggtgcatcgggagaatccagtggtccaatctgcaggtgtttgacgcacgggactgt
aaaacagccaaggaaatgtttgagcatatctgtcgtcatattcagtatgccacaaacaat
gggaatataagatcggccatcacggtgttcccgcagaggacggacgggcagcacgatttc
cgtgtgtggaacagccagctgatccgctacgctggctaccaaatgccggatggctccgtc
cttggagaccctgccagtgtggagttcacacagttgtgcattgagcttgggtggaagccg
aaatatggccgctttgatgtacttccacttgttctccaagcgaacggccaagacccagaa
atatttgatttacctccagaaattgtcctccaagtgccaatggagcatccaaagtatgag
tggtttaaggagctgaacctgaagtggtacgcgctgcctgccgtggccaacatgctgctg
gaggtgggagggctggagttcaccgcgtgtcctttcaatggctggtacatgggaacagag
ataggagtgcgggacttctgtgatgcgcagcgctacaacatcatgaaggaggtagggagg
agaatggggctggaaacaaacaaactgtcatcgttatggaaggaccgagctgttgtagag
atcaatgtggctgtgcttcacagcttccagaaacagaatgtaaccatcatggatcaccac
tcggcctccgagtccttcctgaagtacatgcagagcgagtaccgcgcgcggggcggctgc
ccagcagactgggtgtggattgtgcctcccatgtcaggcagcataacccccgtattccac
caagagatgttgaactatgtcctcactcccttctattactaccaggtggatgcatggaaa
acacatgtgtggcatgatgagacccggaggccaaagaaaaaagaaataaagtttagcatc
ttggcaaaggctgtgctctttgcatcctcactcatgcgaggagcagtggccaccagggcc
aaggtcaccgtgatctacgcgacagagacgggcaagtcagagacgctcgccaacaacctg
tgcagcctgttcagctgtgccttcagcactaagattctgtgcatggatgagtacaatatt
tgtgacctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagat
tctccaggtaacggaaagacctttaaggactccttgctcagactgaaactgctgggaaag
aaaattagatattctgtgtttggtctggggtccagcatgtacccagagttctgtgccttt
gctcatgccattgaccaaaaactggcccaactcggggctgcccagctcgctccagtgggt
gaaggggatgaactcaatgggcaagaagaagctttccgcagctgggcagtcagtgctttc
aagactgcctgtgacatttttaacatccgtgggagacacagtattcagttgcctgacatc
tacacctctgaggaaagctgggaccctaccaattacaggctagtgcatgactcccagccc
atggacctgactaaagctcttgcaagcattcatgccaaggatgtaattcccatgaagctg
aaattcaggcagaatcttcaaagtttgaagtccagtcgtgttaccattctggttaaactt
tactgtgagactaatcaggaagtgcactaccttcctggggaacacatcgggattttcccg
ggcaaccagccagaattagtgcatggcattattgcacgtgtcaaggatgcccctccagct
gatcagactatcaggcttgaaacctgcatagatggtggctactggacaagtcacaaaaag
attccagcctgcacactacccgaggctttgacatacttgcttgatatcactactccaccc
tcccaacaactgctaaaaaaactctcccagctggtgacagcggaaggagacaagcagagg
ctggaagtgctgtgtcagagcacagaagaatacaataaatggaagttttacaacagcccg
aacatcctggaggtcctggaggagttcccctctgctgaggtctccacagctttcttgctg
acacagctgccacttctgaagcccaggtactattctgtcagctcctcctgtgacatgaca
cccagagagattcatctgacagttgcagttgtaaactacaggacaagagatggagagggg
cctttgcaccatggagtctgcagcacgtggctgaacacaatagagctcaatgaaactgtt
ccctgcttcatccgcagtgctaatgagttccacctgccagaggagccggccaagccctgc
attctgatcggctcgggcacagggattgctcccttcaggagcttctggctgcagcgcctc
tatgacctggagcacagagggctcagagggggcgacatgacgttactgttcggctgccgg
cagccagacctggatcacatctacagagaggaaactgaggaaatgcagaggaagggagtc
ctgaaagacctctacacagcttactccagactgcctggccaagagaaagtctatgttcag
gacatcctgcagaggcagctggaggcccgcgtgtgtgaggtggtgcacgggcagcagggc
cacgtgtacgtgtgcggggacgtgcgcatggcgcgggacgtggcgagggcgctgcgggcg
ctgctcgcccgggccctgcgcctcagcccgcagcaggcagacgagtactttctgcagctc
aagagccaaaagcgataccatgaggatatatttggggctgtgttcccacacgaagtcaaa
agagctttgcaacccaccagctga

DBGET integrated database retrieval system