KEGG   Corvus cornix (hooded crow): 104691093Help
Entry
104691093         CDS       T03546                                 

Gene name
LIG3
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    104691093 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccw03400]
    104691093 (LIG3)
Enzymes [BR:ccw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104691093 (LIG3)
DNA repair and recombination proteins [BR:ccw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     104691093 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase CDC45
Motif
Other DBs
NCBI-GeneID: 104691093
NCBI-ProteinID: XP_019143137
LinkDB All DBs
Position
Unknown
AA seq 896 aa AA seqDB search
MAEQRYCVDYAKRGTAGCKKCKEKIVKGMVRIGKIVPNPFTESGGDMKEWYHVKCMFEKL
DKARATTKKIEDITDLEGWEELQDEEKETINKYISEANSKTGGTPKKKVIVQAKLTATGQ
LTTKDPPKKFSGFTAKPKNSEDAPANSAHKSSLSASKCDPKHKDCLLREFRKLCAMVAEK
PSYNVKTQIIQDFLRKGSAGDGFHGDVYLTIKLLLPGVIKIVYNLNDKQIVKLFSRIFNC
NQEEMVRDLEQGDVSETIRIFFEQSKTCPPAAKSLLTIQEVDEFLIQLSKLTKEDDQQTV
LQQISRRCTGNDLKCIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNLQDVVERVLH
NQQEAEKAPGLKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGERVQV
HKNGDHFSYFSRSLKPVLPHKVAHFKDFIPQAFPGGQSMILDSEVLLIDNKTGKPLPFGT
LGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPXPDPVLGDETR
HKSFRPGRHDHRVIREGLEGLVLKDVKGSYEPGKRHWLKVKKDYLNEGAMADTADLVVLG
AFYGQGSKGGMMSIFLMGCYDPKSEKWCTVTKCSGGHDDATLARLQTELDMVKISKDPSK
IPRWLKINKIYYPDFIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRCTRIRDDKDW
QTATNLQQLKELYQLSKEKADFSVVAGEEDESTAGSSGENDENSRSSTPHSSIKSPPSKS
PAKAQKAEESRGVIGSPQKAEEKRGEKRKASEMEDNGKKPLLDIFTGVKLYLAPSVKDFA
RIRRYFIAYDGDLVPEFDTASATHVLGDIDANPGAQRVTARWIWECIRKRRLLAPC
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagaggtactgtgtggactatgccaagcgaggcaccgcgggctgcaagaag
tgcaaggagaagatcgtgaaggggatggtgcgcattgggaaaattgtccccaatcctttc
acggagtccgggggggacatgaaggagtggtaccatgtcaagtgcatgtttgagaagctg
gacaaggcccgggccaccaccaagaaaatcgaagacatcacagacttggaggggtgggaa
gagctgcaggatgaggagaaagaaacaatcaacaagtacatatcagaagccaattccaag
actggaggtaccccgaagaaaaaggtgatagtgcaggcaaagctcactgccacaggacag
ctgaccacaaaagatccaccaaagaaattctctggattcactgccaagccaaagaattca
gaagatgcccctgcaaactctgcccacaagtccagcctgtctgcatccaagtgtgatccc
aagcacaaggactgcctgctgcgggaattccggaagctctgtgccatggtggccgaaaag
ccaagctacaatgtgaaaacacagatcatccaggacttcctcaggaagggatctgcagga
gatggttttcatggtgatgtatacctgaccattaagctgctgttaccaggtgtcattaaa
atagtttacaacttgaatgataagcagattgtaaagctgttcagtaggatttttaactgc
aaccaggaagaaatggtccgggacctggagcagggagatgtttccgagaccatacggatc
ttcttcgagcagagcaagacttgtcctccagcagccaagagcctcctgaccatccaggag
gtcgatgaattcctaatccagctgtccaagctcaccaaggaggatgaccagcagactgtc
ctgcagcagatcagtcgcaggtgtacgggcaacgacctgaaatgcatcatcaggctaatt
aagcatgacttgaaaatgaatgctggagcaaagcacgtgttggatgctctggatcccaac
gcctacgaggcgttcaaggcctcgcggaacctgcaggacgtggtggagcgggtgctgcac
aaccagcaggaggccgagaaggcgccggggctgaagaggaccctgagcgtgcaggcctcg
ctcatgaccccggtgcagcccatgctggctgaggcctgcaagtccatcgagtacgccatg
aagaagtgtcccaacgggatgtacgccgagatcaagtacgacggcgagcgcgtgcaggtg
cacaagaacggagatcacttcagctacttcagcaggagcctcaaacctgtgctcccccac
aaagtagcccattttaaggacttcatcccccaggctttccctggtgggcaaagtatgatc
ctggattcagaagttctcctaattgacaataaaactggcaagccacttccttttgggact
cttggtgtgcacaagaaagctgctttccaagatgccaacgtttgcctgtttgtgtttgac
tgcatctacttcaatgacgtcagcctgatggacaggcccctgtgtgaacggcgcaagttc
ctccacgacaacatggtggaaatccccnaaccggatcctgttctcggagatgaaacacgt
cacaaaagcttcagacctggcagacatgatcaccgagtcatccgggaggggctggaaggg
ctggtgctgaaagatgtcaagggtagttatgaaccagggaaacgccactggctgaaggtg
aagaaggattatctcaatgagggggcaatggctgacacagctgacctggtggtgctgggg
gctttctatggacaaggcagtaaaggtgggatgatgtccatcttcctcatgggctgctac
gaccccaagagcgagaagtggtgcactgtgaccaagtgctccggtggccacgatgacgcc
accctggcacgtctgcagacagagctggacatggtgaagatcagcaaggatcctagtaaa
attccaaggtggctaaaaattaacaaaatctactacccagacttcattgtcccagatcca
aagaaagcccccgtgtgggagatcaccggggccgagttctccaaggccgaggctcacact
gcggacgggatctccatccgcttcccgcgctgcacccgcatccgcgacgacaaggactgg
cagacagccaccaacctgcagcagctcaaggagctgtaccagctctccaaggagaaggct
gatttcagtgtggtggctggagaggaagatgagtccacagctggcagcagtggagagaat
gatgagaattccaggtcttccacacctcacagcagtattaagagtcccccaagcaagtcc
cctgcaaaagcccagaaggcagaagagagcagaggagtcattggatcccctcagaaagcc
gaggagaaacgaggggagaagagaaaagcatcggagatggaggacaacggaaaaaagccg
ctgctggacattttcacgggggtgaagctgtacctggccccctccgtgaaggacttcgcc
agaatccgccgctacttcatcgcctacgacggggacctggtgccggagttcgacacggcc
tcagccacccacgtgcttggggacattgatgccaatcccggcgcccagcgggtgactgcc
aggtggatctgggaatgcatccgcaagcgcaggctgctggccccgtgctag

DBGET integrated database retrieval system