KEGG   Corvus cornix (hooded crow): 104691373Help
Entry
104691373         CDS       T03546                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain isoform X2
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104691373 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DAGK_cat
Motif
Other DBs
NCBI-GeneID: 104691373
NCBI-ProteinID: XP_010401137
LinkDB All DBs
Position
Unknown
AA seq 735 aa AA seqDB search
MSETMSTNEEKKLPLNGRRAIPPNNSNDEENEVPEMEAFGLIPRGFNPRDYLRVEDIYMF
KDPHEINKQEHHTDKYYNPKLIVRRGQSFQIQIYFNRPYKPETDQFWLEFLMGRYPQQNK
GTYIPILVGNLLKPGQWGAKIIHRENNSIRLSIMSSPTCIIGKFRLYVAVLTPFGILRTR
RNSATDTYILFNPWCQMDAVYLDDEKEREEYVLNDVGIVFHGNVEDIKSRSWSYGQFEEN
VLDACLFLMDKAELELSGRGNPIKICRVASAVINSRDDNGVIAGSWNNSYDYGVAPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLVTNYSSAHDNNANLRLDFF
LDDEGKVDTRLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDSPFVYAEVNSDIFYTKMEKNGTQVVEKIDTTHIGQLIVTKEVGGDG
MMDITAEYKFREGSDEERLALETAVMYGVKKQSIQDTTYQPQTDVEMDFQAQKAVLGNDF
KVTITFRNKSRNSYTATTYLSGNIVFYTGVTKSEFKKHSFSAKLQPSSSSSFDIVIKSSE
YMSDLLEQASFHFFVTARINETGKILAMQKAIVLEIPTLRIKTKGELVAGKETSVIVEFT
NPLKQTLENVTLRLEGPGVLRTIKKQFGRIPMNSTLTWEIKCIPMRPGLRKLIASLSCDA
LRHVYGELNVQIQKP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaatgagcactaacgaggagaagaaacttccgttgaacgggagaagagcc
atcccaccaaacaactccaatgatgaagaaaatgaggtccctgagatggaggcttttgga
ttgatacctagaggatttaatcctagagactacttgcgtgttgaggatatttacatgttc
aaggaccctcatgagatcaacaagcaggagcaccacactgacaagtactacaaccccaag
ctgatagtgcgtcggggacagtctttccaaatccagatttacttcaaccggccctacaag
ccagagacggaccaattctggctggagtttttgatgggtcgctacccacagcaaaacaaa
ggcacctacatcccaatcctagtaggcaatctgctgaaacctggtcagtggggagccaag
attatccacagggaaaacaactccattcggctgtccatcatgtcctctcccacctgcatc
attgggaagtttcgcctgtatgttgctgtcttgactccctttggcatccttcggacacgc
aggaattcagcaactgacacatacatcctgttcaatccctggtgccagatggatgccgtg
tatctggatgatgagaaagaaagggaagaatatgtcctgaatgatgttggtattgtattc
catggaaacgtcgaagatataaaatcaagaagctggagttacggtcagtttgaagaaaac
gttctggatgcttgcctgttcctgatggacaaggcagaactggagctctctggtcgtgga
aacccaatcaaaatctgccgtgttgcctcagcagtgattaactccagagatgacaatggt
gtgatagctggatcctggaataattcatatgattatggtgttgcaccttcagcctggacg
ggaagtgtggacattctcttggagtattacagttctaagcaacctgtccgatatggccaa
tgctgggtcttcgctggtgtcttcaacacgtttctgagatgcttggggatacctgcaaga
ctcgttaccaactattcttctgcccatgacaacaatgccaatttacggctggacttcttt
ctggatgacgaaggaaaagtggacaccagacttacaaaagattctgtctggaattatcat
tgctggaatgaagcttggatgaccagacctgaccttcctgttggttttggaggctggcag
gttgttgatgggacacctcaagaaaccagtgatggtatgtacaggtgtggtccagcctca
gttcaagccattaaacatggtcacgtttgcttccaatttgattctcctttcgtctatgct
gaggtgaatagtgacattttttacacaaaaatggagaaaaatggaacccaagtggtagaa
aaaattgacacaacccatattggccagctgattgtgaccaaggaagttggaggtgatgga
atgatggacattactgcggagtacaagttccgagaaggctcagatgaggagagactggct
ctcgagactgctgtgatgtatggtgttaaaaagcaaagtatccaagataccacataccag
ccacagacggatgttgaaatggacttccaagcacaaaaggcagtccttggcaatgacttt
aaagtcactataactttcaggaacaagagtcgcaactcctacactgctactacctacctt
tcaggcaacatagtgttttatacaggagtcacaaaaagtgaattcaagaaacactctttc
agtgcaaaactgcaaccctcttcatccagctcttttgacattgtgatcaaatcgagtgag
tacatgagtgacctgctggagcaagcctcctttcatttctttgtgactgcacggatcaat
gaaacggggaagattctggccatgcagaaggcgatagtcctggaaattcccaccctgcgg
atcaagaccaaaggtgaactggtagctggtaaagaaacgtccgtgattgtagaattcacc
aatcctctgaaacaaaccctggagaacgtcacactccgcctcgagggacctggtgtgctg
agaacaataaaaaagcagttcgggagaatcccgatgaactctacattgacctgggaaata
aaatgcatcccaatgagaccaggtttacgaaagctgattgcaagcctgagttgtgatgct
ttgaggcacgtgtatggtgagctgaatgtccagattcagaaaccatga

DBGET integrated database retrieval system