KEGG   Corvus cornix (hooded crow): 104691421Help
Entry
104691421         CDS       T03546                                 

Gene name
DDO
Definition
(RefSeq) D-aspartate oxidase
  KO
K00272  D-aspartate oxidase [EC:1.4.3.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00250  Alanine, aspartate and glutamate metabolism
ccw01100  Metabolic pathways
ccw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104691421 (DDO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104691421 (DDO)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.1  D-aspartate oxidase
     104691421 (DDO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Glu_dehyd_C FAD_binding_2 Thi4 NAD_binding_8 Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 104691421
NCBI-ProteinID: XP_010401195
LinkDB All DBs
Position
Unknown
AA seq 341 aa AA seqDB search
MASPKVAVVGAGVIGLSTALCITETCPSCSVTVLSDQFSPNTTSDVAAGMLIPHTYPDTP
IHRQKQWFKETFTYLFTISNSAEASEAGIHLVSGWQVFKSTPKEELPFWSDIVLGFRPMS
EAELQKFPQHRFGQAFTTLKCDCPPYLLWLEKRLKATGTQMYTRKVADLWELHSKYDIVV
NCTGMGAHQLVGDKQLFPVRGQVLKVHAPWVKHFIRDGDGLTYIYPGMHRVTLGGTREKG
SWSLSPDPGTTRDIFDRCCSLEPSLQGAHDIEVKVGLRPSRQCVRVQREVLSQGGVKLPV
VHNYGHGAGGFSVHRGTANEAAHLVGECISALQGSSSRAKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacccaaggtcgctgtggtgggggcaggagtcatcggcctgtccacagcactg
tgcatcacagagacttgtcccagctgctccgtgacggtcctttcggaccagttcagcccc
aacacaacgagtgatgtggcagctgggatgctcatccctcacacctacccagacacacca
atccacaggcagaagcagtggttcaaagagaccttcacttacctttttaccatcagcaac
tcagccgaggcatcagaggctggcattcacctggtctctgggtggcaggtctttaaaagc
actcccaaggaagagttacctttctggtcagatattgtgctgggatttcgaccaatgtcc
gaggcagaactccaaaagttcccgcagcaccgatttggtcaggcctttacgacactgaaa
tgtgactgtccaccatacctgctgtggctggagaaaaggttgaaagcaactggcacccag
atgtacaccaggaaagtagcagatctgtgggagctgcacagcaaatatgacattgttgtc
aactgcacaggcatgggagcccaccagctggtgggggacaagcagctcttccctgtcagg
ggacaagtactgaaggttcatgctccgtgggtgaaacacttcatccgggatggggatggc
ttaacttatatctacccagggatgcacagggtgacactggggggaaccagggaaaagggg
agctggagtctctcccctgaccctggcactactagagacatctttgacagatgctgctcc
cttgagccctcactgcagggagctcacgatatcgaggtgaaggtgggcctgaggccatcc
aggcagtgtgtgagagtgcagagagaggttttgagccaaggaggagttaagctcccagtg
gtccacaactatgggcatggggcaggtggcttttcagtgcacaggggcacagccaatgag
gctgctcacctggtgggagagtgcatttctgctctgcagggctcctcatcgagggccaag
ctttga

DBGET integrated database retrieval system