KEGG   Corvus cornix (hooded crow): 104691577Help
Entry
104691577         CDS       T03546                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccw03036]
    104691577 (HDAC8)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104691577 (HDAC8)
Chromosome and associated proteins [BR:ccw03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     104691577 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 104691577
NCBI-ProteinID: XP_010401427
LinkDB All DBs
Position
Unknown
AA seq 338 aa AA seqDB search
MVHSLIEAYCLLDQMKIVKPKVASMEEMASFHTDAYLQHLQKVSEEGDDDHPESVEYGLG
YDCPATEGIFEYAAAVGGATITAAQCLLDGKCKVAINWPGGWHHAKKDEASGFCYLNDAV
LGILRLRQRFDRVLYIDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVTDVGL
GKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYAAFNPDAVVLQLGADTIAGDPMCSFNM
TPEGVGKCLKYVLQWQLATLVLGGGGYNLANTARCWTYLTGVILGRTLSSEIPDHEFFTE
YGPDYVLEITPSCRPDRNEPQRIQEILSSIKGNLKHVV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattcattgattgaagcgtattgcttacttgaccagatgaagatagtcaagcca
aaagtggcctccatggaggaaatggcaagtttccacacagatgcttacctgcagcacctg
cagaaggtcagtgaggagggggatgatgaccacccagagtctgtggagtatggactgggt
tacgactgtccagccactgaagggatctttgagtatgcggcagctgtgggaggagccacc
atcactgcagcccagtgcctgctggacggcaagtgcaaggtagcaattaactggcctgga
gggtggcatcatgcaaagaaggatgaagcttctggcttctgttacctgaatgatgctgtc
ttggggatcctgcggctgcgccagagatttgaccgtgtcctttatatcgatttggatttg
catcatggggatggagttgaggatgcctttagtttcacctcgaaagtcatgactgtttct
ctgcacaaattttcaccaggatttttcccaggcaccggtgatgtgacagatgttggcctg
ggaaaaggtcgctattacagtgtgaacgtgcccattcaagatggcattcaggatgagaaa
tattaccagatctgtgaatcagtgctgaaggaggtgtatgctgccttcaacccggatgca
gttgtgctgcagctgggggcggacaccattgctggagaccccatgtgctctttcaacatg
acacctgagggagtgggcaagtgtctcaagtatgtcctgcagtggcagctagcaactctt
gtcctgggaggaggaggttacaaccttgccaacacagctcgctgctggacatacttgact
ggggtcatccttgggagaacactgtcctctgagatccctgatcatgagttcttcacagag
tatggtcctgattacgtgttggagatcacaccaagctgcagaccagaccgcaatgagcca
cagagaattcaagaaattctgagctctatcaaagggaatctgaagcacgttgtttag

DBGET integrated database retrieval system