KEGG   Corvus cornix (hooded crow): 104692245
Entry
104692245         CDS       T03546                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04020  Calcium signaling pathway
ccw04260  Cardiac muscle contraction
ccw04261  Adrenergic signaling in cardiomyocytes
ccw04270  Vascular smooth muscle contraction
ccw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104692245 (CACNA1C)
   04020 Calcium signaling pathway
    104692245 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104692245 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104692245 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    104692245 (CACNA1C)
   04270 Vascular smooth muscle contraction
    104692245 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccw04040]
    104692245 (CACNA1C)
Ion channels [BR:ccw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104692245 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 104692245
NCBI-ProteinID: XP_019144238
LinkDB
Position
Unknown
AA seq 2195 aa
MFQALVRQAYHPLASHQPGEPDTKYKGKVVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLMDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITAD
GESPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQI
LFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWE
NSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIA
FKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAV
SAASEDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTTQRPLHINKSGNNHGDTESPSHEK
LVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEA
PWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEM
LAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQK
TVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPPATPCNRGWPQQTIPTLRLDGA
ESSEKLNSSLPSVHCGSRYPESGGSPRRARPVSLTVPSQTAGSSRQLHGSASSLVEAVLI
SEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFANCRD
PGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6588 nt   +upstreamnt  +downstreamnt
atgtttcaagccttggttcggcaagcgtatcaccccctggccagccaccagccaggggaa
cccgacacgaagtacaaggggaaggtggtgcatgaaactcagctgaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaacgccaat
gcggccgcagggctcgccccggagcacatccccacgccgggggcagctctgtcctggcaa
gctgcgatcgatgctgccaggcaggccaagctgatgggcagcgctggcaacgcaaccatc
tccacagccagctccacgcagaggaaacggcagcagtatggcaagcagaagaagcagggt
accaccacagccacgcgtccgccccgggcgctgctgtgcctcacgctgaagaatcccatc
cggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatacggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggattcgatgtt
aaagcactgcgggctttccgagtattacgtccactacggctggtgtctggggttcccagt
ctccaggtggttttaaattcaattatcaaggctatggtccctttgttgcatattgccctg
ctggtgctgtttgtcattattatctatgccatcattggactggagttattcatggggaag
atgcacaagacctgctaccatgtgcaagggggactgatggatacccctgcggaagacgat
ccgtccccgtgtgccccccagtctgcccacgggcggcagtgtcagaacggcaccgagtgc
aaggcgggctgggagggacctaagcacggcattaccaactttgacaattttgcttttgcc
atgctcacggtgtttcagtgcatcaccatggagggctggacagatgttctgtactggatg
caggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtcatctttgga
tcctttttcgttctaaatctggttcttggtgtgttgagcggggagttttccaaagaaaga
gaaaaggctaaggctcgaggcgatttccagaagctacgggaaaagcaacagctggaggag
gatttgaagggatacttagactggataactcaagcagaagatattgatccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagcgagaccgag
tccgtgaacaccgacaacgtccctggagcagatatggaaggcgagaactgcggcgcaagg
ctggcgcatcggatctcaaaatcaaaatttagtcgctactggcgccgatggaatcgattc
tgcagaaggaagtgccgtgctgctgtcaagtccaatgtcttctattggctggtgatcttc
ctcgtgtttctcaacaccctcaccattgcctctgagcactacaaccagccagactggctc
acggaggtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagcctcggtctccaggcctattttgtgtccctcttcaaccgctttgac
tgtttcattgtgtgcggaggcatcctggaaacgatcctggtggagacaaagatcatgtca
ccgctgggcatttcggttttgagatgtgtcagactcctgagaatatttaaaatcacaaga
tactggaactccctgagtaatcttgtggcttcactcctgaattcagtccgctccattgcc
tccctgttgctgcttctcttcctcttcatcatcatcttctccctcctggggatgcagctc
tttgggggcaagtttaactttgatgagatgcagaccaggaggagtacatttgacaacttc
cctcagtccctcctgactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaactatatcctgctgaatgtatttttggccattgct
gtggacaaccttgctgatgctgagagtttaacatctgcacagaaagaggaggaagaggaa
aaagaaaggaaaaagctagctaggactgctagtcctgaaaagaaacaggagatggaaaaa
acagctgtggaggaagagacaaaggaggagaaaattgagctgaaatcgatcactgctgat
ggagaatccccacctgctaccaagatcaatgtggatgattatcagcccaacgaaaacgaa
gaaaagagcccttatcccacaacagaagcaccagcagaggaagatgaggaagaaccagag
atgcctgttggccctcgacctcgcccgatgtctgagctccacctcaaggaaaaggctgtg
cccatgcctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccac
tgccatcgaatcgttaacgataacattttcaccaacctgatcctatttttcatcttgctc
agcagcatctccctggcagctgaggaccccgtgcgacacctctcctttaggaaccaaatt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaagatg
accgcatacggggctttcctccacaagggctccttctgcaggaactatttcaacatctta
gacctgctggtggtcagcgtttctctcatctcctttgggatccagtccagtgccattaac
gtggtgaagatcctgcgtgttctgcgggtccttaggcccctgagggccatcaacagagcc
aaaggactaaagcatgtggtccagtgtgtgtttgtggccatccgaaccatcgggaacatt
gtgattgtcaccactctgctgcagttcatgtttgcctgcattggagttcagctgtttaag
ggcaagctgtacagctgcactgacagctccaagcagacagaagcagaatgcagagggtac
tacatcacctacaaggatggggaggtcagccagcccatgatacagccccgcagctgggag
aacagcaagttcgacttcgacaacgtcctgactgccatgatggccctcttcaccgtctcc
acctttgagggctggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatctccatcttctttattatctacatcatcatc
attgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaa
ggagagcaagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagagtat
gccctgaaagcccggcctctgcggagatacatccctaaaaaccagtaccagtacaaagtt
tggtatgtggtcaactccacctattttgaatacctgatgttcgttctgatcctgctgaac
accatctgcctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaat
atcctcaacatgctcttcactggcctcttcactgtggagatggtcctgaaattaattgcc
ttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctct
tcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgc
gtgatgcgtctcgtgaagctcctgagccgaggggagggcatccggacactgctttggacc
ttcatcaagtccttccaggctctcccctatgtggctcttttaatagtgatgttgttcttc
atctacgctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgataccacagaa
atcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgcttttcaggtgt
gccacaggcgaggcctggcaggaaatcatgctggcatgtctcccggacaagaagtgcgac
ccggagtcagagccagccaactccacggaagccgatcactcctgtggcagcagcttcgcc
gtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaacctttttgta
gctgttataatggataacttcgattacctgacacgggactggtccattttaggaccacac
cacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaagggccggatc
aaacacttggatgtggtgacgctgctccggcggatccagcccccgctgggcttcgggaag
ctctgccctcaccgcgtggcttgcaaacgccttgtctccatgaatatgccactgaacagt
gatgggaccgtcatgttcaatgccactctctttgcattggtcagaacagcactgaggatc
aagacagaaggtaacctggagcaagccaatgaagagctgagagcaataattaagaaaatc
tggaagcgcaccagtatgaagctgctggaccaggtggtgcctcccgcaggtgatgacgag
gtgaccgtcgggaagttctacgccaccttcttgatccaggagtatttccggaagttcaag
aaacgtaaagagcaggggctggtggggaagccctcccagcgcaatgcgctgtccttacag
tttgctgttttgcaggctggtctgcgcacactccacgacatagggccagagatccgacga
gcaatctctggagacctgacagctgaagaagagctggacaaggccatgaaagaagctgtt
tctgctgcctctgaagatgatatcttccggagagctggaggcttgtttggaaaccatgtg
agctattaccaaagtgacggcaggagtggcttcccccagacattcaccacccagagacct
ttgcacatcaataagtctggcaacaaccacggagataccgagtctccatctcacgagaag
ctggtggactccaccttcactcccagcagctactcatcttcaggctccaatgccaatatc
aacaatgccaacaacactgccctgtgtcgcttccccagcccgcccagctaccccagcact
gtcagcacagtggaaggccatgggacccccttgtcacccaccatatgtgtgcaggaggct
ccttggaaactcccatccaaaaggacacattactacgagaccctgggacgctccagttcc
agagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgac
gaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctctctaccgaaatg
cttgcataccaagatgatgaaaacagacaactcactccaccagaaaacaacaaaggagag
gacacccggcactctccgaagaaggggtttctgtgctcctcagcactaggtcgaagagca
tcttttcacttagagtgtttgaaaagacagaaaaaccagggcgtggacgtctcgcagaag
acagtcctgcctttgcatctggtccatcatcaggcattagcagtggccggcctgagtccc
ctgctccagcgaagccattcccccaccatgttctctcggctgtgtgctacgcccccggcc
acgccctgcaaccggggctggccgcaacagaccatcccaaccctgcgcctcgacggggca
gagtcctcggagaagctcaacagcagcttgccgtccgtccactgcggctcccggtaccct
gagagcggcggcagccccaggagagcccggccggtgtccctgaccgtgcccagccagacc
gcagggagcagccggcagctccacggcagcgccagcagcctggtggaagcggtcttgatt
tcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaggag
ctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctcttgccttttgctaactgcagggac
ccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtaggata
agtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system