KEGG   Corvus cornix (hooded crow): 104692289Help
Entry
104692289         CDS       T03546                                 

Gene name
WNK1
Definition
(RefSeq) serine/threonine-protein kinase WNK1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccw01001]
    104692289 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:ccw01009]
    104692289 (WNK1)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104692289 (WNK1)
Protein kinases [BR:ccw01001]
 Serine/threonine kinases: Other
  Wnk family
   104692289 (WNK1)
Protein phosphatases and associated proteins [BR:ccw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104692289 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 104692289
NCBI-ProteinID: XP_019144178
LinkDB All DBs
Position
Unknown
AA seq 2545 aa AA seqDB search
MVWLLGGPMQGQQSDSDPLQADPVPFDPPGRWTKGRPRSCPPQHIGPLAPRTHGDEATAL
PPTSAAGSLSAASREFEERRTQQEDIEELETKAVGISPDGRFLKFDIEIGRGSFKTVYKG
LDTETTVEVAWCELQDRKLSRSERQRFKEEAGMLKGLQHPNIVRFYDSWESTVKGKKCIV
LVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFIT
GPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATS
EYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKGERYAIKDLLNHAF
FQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQ
EMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQSVQEEQENILQEEGSQKQQLEQQQP
SSASHAGSKHPQSVTGTTSVPTASASVSTQVEPEEPEADQHQQLQFQQPSISVLSDGTVD
SGQGSSVYTESVSSQQTVSYGSQHDQSVSNTGVQGYTASVGQVQSQQHGGYQPPAALQRG
RSMSVCVPHLPALPCMSCIPLSAPCTPPPALSAPLSPFYLRTVPEETFAEKLSKALESVL
PMHSASPRKHRRSSLPSLSVSPPQHPRGGTPPFPDSQIFFPTVHERPVSFSPPPVCPPKV
AIAQRRKSTSFLEAQTCHFQPLLKTGQSLVPPGGSPTNWTPEAFVMLGTAAQRVAGEPLH
VQVNPVFEQAPVHSDYRSGPTPPEDARYRMHPEAVYLVGMHYPSQTQVQGQPASSNASVP
SQPTQHTQQSAQQPASSQQPGQYQLQQPSVSASTTPAQTVSQTQTSQIMPMPQAAAGTQL
PVSQPVSIIQGEPQLPVAASSLPQPSVAPSVPIGSHFLPMGQALPTSVVPQFPVSQLPVA
APHVTVAQPGFQSLPLSMAAGMNQPLLTLATSAAAAAVPVGPTAVPSQLPTLMQPVAQLP
SQVLPQLLQPAVQSVGLPVSIGQAAEASLPAGDALYQGFPSRLTPQYPGDSSVAPSSAVA
SASIPSAVLSPPMPTDAMAQSAYLAPVVQPYGEQNVLVSMGSLGGQVQVPQPPVSLAQQA
SSASSQQAVVEGTQGVSQTASSETLPATQPAQSTPLASSMDSAHSDVASGLSDGNENVPA
SSGRHEGRTTKRHMRRSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTFK
FDLDGDNPEEIASIMVQNEFILATERDSFVEQVREIIEKADEMLSEDASVEPEGDQGLES
MQTKDDGFFPGSQKLEFKQPDPTSSMPQRIGVPSSSFTQVVHSAGRRFIVSPVPESRLKE
QGFFTSAVSGGNETSDMVVASPVHGPGMNLSHSASSLSLQQAFSEMGHAQMTEGPSTAPP
VFNQTIPPFPPALSTMAGSGATPASVATSSVSVPSSTGVSLPGSVTLPSENAAVGVAPST
SVPSSISPPSASQPGQQSTGVTSSVSAPASFSISAMSQPAQPVTADIAPSISTPSALALP
STQVPGVTGLGAVAPAVTSQSTPQIVSSMAAPQTSVALSLAQNVALQLPQLSSSGSVCSL
AETTVVSAPQSLPETGHSLDKSHPCNAAGLSLPISAPLSSSAASSICGSVSQPVIHPLLV
PSGITSTPVLPQISGATPMLPQVPLPGVLPQPVTNLPAVQQTLIHSQPQPAPLPNQPHIH
CLEADADAQSKAPGIDDIKTLEEKLRSLFSEHGNVGTVHPSVSLETSLVMETTVVPGIPT
TAVAPTKPLTSISTCIPPSSLPLGPTGLPVLTPVATPGQVITPVSYISASSSIATAAVKP
GTSPSKPPLSRVPVLPIGSDLPAGTPSSEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPE
TVPVTSAPACSVPSVASTTVTGPVSTATQSLKDALASGDGESGAVAAAAGASVLKMGRFQ
VSVAVDDVLKEGDKPETKPVQFETTSTDSSSLSGSSPESTLVKQAESRKSGAAAAASLDV
VDGLAQAAPTPPPPPADAAQATKVGRFQVTTATDQVGRFSVAKARDEVSCAQKEPVTLPL
SVGLEQVASSAAAPKKELESRQSPHMNGPSSDPEAAFLSGMAKDLDDGSGSPDSVQHLGS
KISLPVQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLREKHLKEIQELQSRQKQEIESL
YMKLGKAPPAVIIPPAAPLSGRRRRPTKGKSSKSSRSSSQGHKSPQLSGNLSAQSAPSVL
PPQQTLHPPGSVPETGQNHLLQPLKPSPSSENLYSAFTSDGALSVPSLSAPGQGCAKFNC
ASERVTFKPGGRRTRFLSTPCLALWKMVKKVCPCNQLCRTSSTNTVGAAVNSQAPQTQPT
AIASSRKGTFTDDLHKLVDNWARDAMNLSGKKVGKGHSSYEGPGMARKFSAPGQLCISMT
SSLGATPIPAASATSLGPFSKAMCPPQQYGYPAASFPPPWSGAGGPAQPQLGQFQPVGAT
SLQSFNISNLQKSVSNPPGSNLRTT
NT seq 7638 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggctcctggggggtcctatgcagggccagcagtcggactctgatcctttgcaa
gcagacccggtgccttttgacccgccgggcaggtggacgaaggggcggccgcgcagctgt
cccccacagcacatcggtcccctggcccccaggacgcacggggacgaggcaactgcgcta
ccccctaccagtgccgctggcagtctgtcagctgccagccgggaatttgaggagcggaga
acacagcaggaagacatcgaggagcttgagaccaaggcagtgggcatctccccggatggc
cgcttcctgaagtttgacatcgagattggaagaggctctttcaaaactgtgtataaagga
ctggatactgaaaccactgtggaagttgcgtggtgtgagctacaggatcggaagctgtcc
aggtcagagcgacaaagatttaaagaggaagctgggatgctgaaagggcttcagcatccc
aatattgtcaggttctatgattcctgggagtccacagtcaaaggaaaaaagtgtattgtt
cttgtgacggagctcatgacatctggaacattgaaaacgtatttgaaaagatttaaagtg
atgaaaattaaagtactgcgaagctggtgccgtcagatactgaaaggcttacaatttcta
cacacacgcactcctcccatcattcatagagacttaaaatgtgacaacatcttcattact
ggccccactggatcagtcaagattggagaccttggtctggcaaccctgaaacgagcttct
tttgccaaaagtgtgataggtaccccagagttcatggcccccgagatgtatgaggagaaa
tatgatgaatccgttgatgtatatgcttttgggatgtgtatgctagagatggccacgtct
gagtatccctattccgagtgccaaaatgccgcgcagatctaccgtcgagtgaccagtggt
gtcaagccagccagctttgataaagtagcaatccctgaagtgaaggagattattgaggga
tgcattcgtcaaaacaaaggtgaaagatatgctattaaggaccttttgaatcacgctttc
ttccaagaggagactggagtacgggtagaacttgcagaggaagacgatggagaaaaaatt
gccattaaactctggctgcgaattgaagacatcaaaaaactcaagggcaaatataaagat
aatgaggcaatagagttttcatttgatttggaaagagatgtcccagaggatgtagcacag
gaaatggtggagtctggctatgtctgtgaaggggatcacaagacaatggcgaaggctatc
aaggacagggtatctttgattaagcgcaagcgagagcagcgccagtcggtgcaagaagaa
caggagaacatacttcaggaagaaggtagtcagaagcagcagctggagcaacagcagcca
tcaagtgcttcccatgcagggtcaaagcatccccagtctgtcactggtactacttctgtc
cccactgcttcagcatcggtttctacgcaagtggagcccgaagagccggaagctgatcaa
caccaacagctgcagttccagcaacccagtatatctgttctttctgatggaacagttgac
agtggccaggggtcatccgtgtacactgaatctgtgagcagtcagcagactgtgtcctat
ggttcccagcacgaccagtcagtctcaaacactggagtccagggatacacagcttcagtt
ggccaagtgcagtcccagcagcatggaggatatcagccacctgcagcgcttcaacgtggt
cgtagcatgtcagtttgtgtcccccaccttcctgctcttccctgtatgtcctgcatccct
ctcagtgctccttgcaccccaccaccagcgctgtctgcacctctttctcctttctacctt
cggactgtccctgaagaaacctttgcagaaaagctttctaaagccctggaaagtgtcctg
cccatgcactctgcctctccacgcaagcatcgacgctccagcctgccctccctctctgtc
agtcctcctcagcatcctcgtgggggaacaccaccgttcccagattcacagatatttttc
ccaaccgttcatgaacggccggtgtctttctcaccaccacctgtctgcccgccgaaggtg
gcaattgctcagcggcgcaagagcacttcatttttggaagctcaaacttgccacttccag
ccattgctgaagactggccagagtttagttccacctggtggtagtcccaccaattggact
ccagaggcatttgttatgctaggcacagcagctcagagagtcgctggagagcctctgcat
gtgcaagttaatcccgtgtttgagcaagctcctgtccacagtgactatagatctggacca
acacctccagaggatgctcgctacagaatgcatccagaagctgtgtatttggtgggcatg
cactatccatcacagacacaggtgcaaggccagccagcctcaagcaatgcatcggtgcca
tcccagcctactcagcacactcagcagagtgcacagcagccagcctcttcccaacagcct
ggacaataccagctgcagcagccctcagtttctgccagcaccactcctgcacaaactgtc
tctcaaactcaaacttcacagatcatgccaatgcctcaggcagcagctgggacacagctt
cctgtttcccaaccagtgtcgatcatccaaggcgagcctcaattacctgttgcagcatct
tctctccctcagccttcagttgccccatcagtccccattggctctcattttctacccatg
ggacaggccttgccaacttccgtggttccccagttcccagtgtctcagttgcctgtagca
gctcctcatgtgacggtggctcagccaggtttccagtcgctgcccctttcgatggcagct
ggcatgaatcagccactgctgacgctggccacgtctgccgcggcagctgctgttcccgta
ggaccaacggctgtccctagccagctccccacactgatgcagccggtggctcagctgccc
agccaggttctcccgcagctcctgcagccggctgtccagtccgtgggattgccagtcagc
attggacaagctgctgaagcttcacttcctgctggagatgctctttaccagggcttccca
tctcggctgacaccgcaatacccaggggactcgagcgttgcaccttcctctgctgtggcc
tctgccagcattccttctgctgtgctgtcccctcccatgcccacagatgcaatggcccag
tcagcctaccttgctcctgttgtgcagccgtatggggaacagaacgttttagtttccatg
ggcagcctgggaggacaggttcaggtgccccagcctcctgtgagtttagcacaacaggcc
tcatctgcctcctcgcagcaggcagtcgtggagggtactcagggagtctcacagactgct
tcttcagagactcttccagcaacacagcctgctcagtctacccctttggcttcttctatg
gatagtgcacattctgatgttgcttcaggattgagtgatggcaacgagaatgtcccggct
tccagtggaaggcacgaagggaggacgacgaaacgtcacatgcgcaggtctgtccgcagc
cgctctcgccatgagaagacttctaggccgaagctgagaattctcaatgtttcaaacaaa
ggtgatcgggtagtggaatgccagctagagacacacaatcggaaaatggttactttcaaa
tttgatttggatggtgataaccctgaggaaatagcttcaatcatggtgcagaacgagttt
attttagcaacagagcgagactcatttgtagaacaggtacgagagattattgagaaagca
gatgaaatgctaagtgaggatgcaagcgtggagccagaaggggatcaggggctggagagc
atgcagacaaaagatgacggcttcttcccggggtcgcagaaattagagttcaaacagcca
gatcctacatcttccatgccacaaagaataggggttccttctagctcctttacccaggtt
gttcattctgcgggaagacggttcattgtcagcccggtccctgagagccgactgaaagaa
cagggctttttcacatctgctgtttctggaggaaacgaaacttcagatatggttgtagca
tctccagtacatggtcctggaatgaatctctcccactcggcatcatcactgagcttgcag
caagccttctctgagatggggcatgctcagatgacagaaggacctagcacagctcctcca
gtgttcaatcaaaccataccaccatttccacctgcactttctaccatggcgggcagtggt
gcaactcctgcatctgtggctacttcttcagtatctgttccctccagcactggtgtttct
cttccaggatctgttactttgccttcagaaaatgcagctgttggagttgcaccaagcaca
agtgtgccaagctctatttctccaccttcagcctcacagcctggacagcaatcgaccggt
gtcacttccagcgtgagcgcccctgcttctttctccatatctgccatgtcccagcctgcc
caaccagtgactgcagacattgcccccagtatcagcacaccatcggctttggcactgcca
tctacccaggttcctggtgtcactggtctcggtgctgtggcaccagctgtgacatcccag
tctactcctcagattgtgagtagtatggcagcaccacagacatctgttgccctgtctctg
gcccagaacgtggctttgcagcttcctcagctcagtagcagtggctctgtgtgcagtctg
gcagaaacaacagtggtaagtgctccacagtcactacctgagactgggcactctctggat
aaatcacatccctgcaatgcagctggcttatctcttccaatctctgcacctttatcatcc
tcagcagcatcaagcatatgtggttcggtctctcagccagtgatccaccccttactcgtt
ccatcaggaattacatcaacacctgtcctaccccagatttcaggtgcaacacccatgttg
ccccaggttcccttacctggtgtcttgccacaaccagtcactaacttgcctgcagtacag
cagactttgatacacagccagcctcaaccagctccattgcccaaccagcctcacattcac
tgtctggaggctgatgctgatgctcagtctaaagcccctggtattgatgacataaagacc
ctggaagaaaagctgcggtctctcttcagtgagcatggtaacgtgggaacggtgcatccg
tcagtgtctctggagacctcgctggtgatggaaaccaccgttgttcctgggatcccaacc
actgctgttgcaccaaccaaacccctgacatccattagcacttgtatacctccaagcagt
ttgcctcttggaccaactggcttgccagtgctgactccagttgccactcctgggcaagtg
atcacccccgtcagctacatctcggcctcgagcagcatcgccacagcagcagtgaaaccg
gggacctctccttccaagccccctctcagcagggtaccggtgctaccaataggttctgac
cttccggctggcactccatccagtgagcagctgccaccttttccaggaccttcactaact
cagtcccaacagccactggaagatctggatgctcagctgagaagaacccttagtccagag
accgtcccagtgacatctgctcctgcctgttctgtgccctcagtagcatcaacaacggtt
actgggccggtgtccacagcaacacagtctctgaaggatgctttggcatcaggtgatgga
gagagcggtgctgtggctgccgcagcaggagccagtgtgctgaagatgggacggtttcag
gtatccgtggcagtggatgatgtgctaaaagagggtgacaaacctgaaacgaagccagtg
caatttgaaaccacctccactgattcttcaagcctttctggcagcagcccagagagcacg
ctggtgaagcaggctgagtctcggaagagcggggctgcggccgccgcctccttggatgtg
gtggacggcctggctcaggcggctcccacgccgccgccgccgccggcagatgctgctcag
gcgaccaaggtcgggcgcttccaggtgacaacggccacggatcaagtggggcgcttctcc
gtggcaaaggctcgcgacgaggtcagctgtgcccagaaagagcctgtgactcttcctctc
tctgtgggcttggaacaagttgcttcttcagctgcagctccgaagaaagagctggagtcg
aggcagtccccacacatgaacggtccatcctctgatccggaggccgcctttctgagtggg
atggctaaggatttggatgatggctcagggagcccagactctgtccagcacctgggatca
aagatcagcctccctgttcagagccttagcaactccttcaactcttcctacatgagcagt
gacaatgagtcggacattgaagatgaagacttgaaattggaactccgtcggttacgggag
aagcaccttaaagagatccaggagctgcagagtcgccagaagcaggagattgagtcactc
tacatgaaactgggaaaggccccacctgcagtaattattcccccagctgcacccctttca
ggaagaaggagacgacctacgaaaggaaaaagcagcaagtccagtcgtagcagctcccag
ggacataaaagccctcagctatcaggcaacctgtcagctcaaagtgcaccatcagtcttg
ccccctcagcagacccttcatcctcctggtagtgtgccagagactgggcagaaccatttg
ttacagcccctcaaaccttcaccttccagtgaaaatctctactctgccttcaccagtgac
ggtgccctctcggtaccgagcctttcggcaccgggccaaggctgtgcgaagtttaactgt
gcatctgagagagtgaccttcaagcctggtggcaggaggacccgatttctgagtacgccc
tgcttggctctttggaagatggtgaaaaaagtctgtccttgcaaccagctctgtaggacc
agcagcaccaacaccgtgggggctgcagtgaacagccaggctccccagacccagcccact
gccatcgcctcgagccgcaaagggaccttcacggacgacctgcacaagctggtggacaac
tgggcccgggatgccatgaacctgtctggcaagaaggttggcaaagggcacagcagctat
gagggccctggaatggcaagaaaattctcggcaccaggtcagctctgtatctctatgaca
tcttccctgggtgctacgcccatccctgcagcatcagctacctctttaggtcccttcagc
aaggccatgtgccccccgcagcagtacggttaccccgcagcgtccttccccccgccctgg
agcggggccggggggccagcacagccacagctcggccagttccagcccgtgggtgccaca
tctttgcaaagcttcaacatcagcaatttgcaaaagtctgtcagcaaccctccaggctcc
aacctgcggaccacttag

DBGET integrated database retrieval system