KEGG   Corvus cornix (hooded crow): 104692419
Entry
104692419         CDS       T03546                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04012  ErbB signaling pathway
ccw04068  FoxO signaling pathway
ccw04110  Cell cycle
ccw04115  p53 signaling pathway
ccw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104692419 (CDKN1A)
   04068 FoxO signaling pathway
    104692419 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104692419 (CDKN1A)
   04115 p53 signaling pathway
    104692419 (CDKN1A)
   04218 Cellular senescence
    104692419 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104692419
NCBI-ProteinID: XP_010402755
LinkDB
Position
Unknown
AA seq 205 aa
MCLSVPSGLPHCRAQPSLSHLGYRVLCLGSQHSPVFAPVIPAPVTCSGFPPASTMPLSQS
RAGQTPCSSKACRNLFGPVDHDQLQHDFEDKIRQQLEEAQQRWNFDFETETPLEGPFKWE
RILVAEQPPQEVHSLVRAVISSDSRSSLAHRVPPKDRVGRICPEESQQSSQVYKAGSPQS
LKRGQTTIKDFYSAKRRIVPARPRP
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtgtctgtcagtcccctctgggctgcctcactgcagagcccagcccagcttgtcccac
cttggctaccgtgtgctttgccttggtagccagcactctcctgtgtttgctcctgtcatc
ccagcccccgtaacttgctctggtttccccccagccagcacgatgccgctgtcccagagc
agggctgggcagaccccatgcagcagcaaggcctgcaggaacctctttggccccgtggac
cacgaccagctccagcatgactttgaggacaagataagacaacagctggaagaagctcag
cagcgctggaacttcgactttgagacagagactcccttggaagggccgttcaagtgggag
aggatcctcgtggctgagcagccgccccaggaggttcacagcctggtcagggctgtcatc
agcagtgacagcaggagctccttggcccacagggtcccccccaaggaccgtgttggcagg
atttgccccgaggagtctcagcagagctcgcaggtttacaaggctggttccccacagagc
ctgaagcgtgggcagaccacgatcaaagacttctacagtgccaagcggaggatcgtccct
gcccggccccggccgtga

DBGET integrated database retrieval system