KEGG   Corvus cornix (hooded crow): 104693572
Entry
104693572         CDS       T03546                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104693572
   04020 Calcium signaling pathway
    104693572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccw04040]
    104693572
Ion channels [BR:ccw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104693572
SSDB
Motif
Pfam: Ion_trans GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 104693572
NCBI-ProteinID: XP_019145594
LinkDB
Position
Unknown
AA seq 1726 aa
MALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALE
QHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVL
SGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLF
FAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGI
TQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGV
LSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALDV
LRRATIKRNRTDAMSSDEHCVDISSVGERRLAQRRRLNPTLGNPSSHSGLKGARVDGASY
LRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLG
LFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLL
RIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPS
ANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNV
FLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERERRRRHHMS
VWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVTLEKCTEEQGKGERP
LAEGPEQPVPGANPSGGEDRTSPRAKRDKDMWQQKSCHGNCEPGEQDGAGGSIEDRARMR
QSQRRSRHRRASKEGKDTAGILGSRSASQEMGLEEASTVEGAQDGDRRGDVAAAEALIPG
EPEASGESIRTNGVPAGDADLIGSAKKGSPPHAGTELSQGKTGNLMEQDCSSPDTSEQAL
LEPSRTVSLSEPDLSSITPNTEKATESTAIMIDVHDSAVVQISNKTDGEASPLKEAETKE
DEEEMEKKKQKKEKSKTGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAAS
SIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILD
FIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSL
KNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTQKDCIGNYVDHEKNKMEVKCR
EWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVY
FVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHT
FQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECV
LKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKL
LRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNF
RSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSF
IFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYE
MLTLMSPPLGLGKRCPSKVAYKPGRCVFRYCFPSAVFFSLLRRDWC
NT seq 5181 nt   +upstreamnt  +downstreamnt
atggctctgtacaaccccatccctgtccggcagaactgcttcaccgtcaacagatcgctc
ttcctctttggggaagagaacatagtcaggaaatatgccaagaagctcatcgactggcct
cccttcgagtacatgatcctggcaaccatcattgccaactgcatcgtgctggccctggag
cagcacctgcccgaggatgacaagacgcccatgtcacggagattagagaagacggagccc
tacttcattgggattttctgcttcgaggctgggattaagatcgtggccctagggttcgtt
ttccacaagggctcgtacctgcgcaatggctggaacgtcatggacttcattgtggtcctc
agcggcatcctcgccacggccgggacacacttcaacacccacgtggacctgcggacactg
cgggccgtgcgcgtgctcaggcctctgaagctcgtctcgggcattcccagcttgcagatt
gtcctgaaatccatcatgaaggccatggtgcctctcctccagatcggtctgctgctcttt
tttgccatcctcatgtttgccatcatcggcctggagttctacagcgggaagctgcaccga
gcctgctacacaaacaattcaggtgaactagaggagctggaccctccccatccctgcggg
gtgcagggttgccccccgggctatgagtgccgggagtggatcggtcccaacgacgggatc
acgcagttcgacaacatcctctttgctgtgctgaccgtcttccagtgcatcaccatggaa
gggtggaccacagtcctgtacaataccaatgatgccttaggagccacctggaactggctg
tacttcatccccctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtg
ctgtcaggggagtttgccaaagagcgagagcgcgtggagaaccgccgagccttcatgaag
ctgcggcgccagcagcagatcgagcgggagctcaacggctaccgggcatggatagacaaa
gcggaggaagtcatgctggctgaagagaacaaaaactcggggacctcagccttagacgtc
ctcaggcgagccaccatcaagcggaaccggacggatgccatgtcgagtgacgagcactgc
gtcgacatctcctccgtgggcgagcggaggctggcgcagagaagacgtcttaatccaacc
ttgggtaacccctcgagtcactctggcctcaaaggcgccagggtggacggtgcctcctac
ttacggcacaaggagcggctcctgcgcatctccgttcgccacatggtgaaatcccaggtc
ttctactggatcgtactgagcctggtggctctcaacactgcctgtgtggccatcgtccat
cacaaccagccagcctggctcacccacttcctctactatgcagagttcctgtttcttggg
ctcttccttctggagatgtccttaaagatgtacgggatggggccacgcctttacttccat
tcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttcgaagtggtttgg
gctatattcagaccaggaacctcttttggaatcagtgtcctacgagctcttcgtctcctg
cgcatatttaaaataaccaagtactgggcatccctgaggaacttggtggtctcgctgatg
agctccatgaaatctattatcagtctgctcttcctccttttcctcttcattgtagtcttt
gccctgctgggaatgcagctgtttggaggcaggtttaacttcatggatgggactccatcg
gccaactttgacaccttccctgcagccatcatgacagtgtttcagatcctgacaggcgag
gactggaacgaggtgatgtacaacggcatccgctcccagggaggcgtgcgctcagggatg
tggtcctccatctacttcatcgtcctcaccttgtttggaaactatactctgctgaacgtc
ttcttggccattgctgtggacaacctggccaatgctcaagagctcaccaaggatgagcag
gaggaagaggaggcctttaaccagaagcacgcccttcagaaagccaaagaagtcagcccc
atgtctgccccaaacatgcctgctatcgagcgggagcggcgccggcggcaccacatgtca
gtgtgggagcagcgcacaagccagctgcgccggcacatgcagatgtccagccaggagggc
atcaacaaggatgagccgcccctcatcaatccccacgccagcatcttccgcaggaagaaa
cctggggatggcgtcaccctggagaaatgcaccgaggagcaggggaagggtgagcggccg
ctggccgagggacctgagcagccagtcccaggggccaaccccagcggtggtgaggacagg
acatcgccccgggccaagcgggacaaggacatgtggcagcagaaatcttgccacgggaac
tgtgagccaggagaacaggatggggcaggaggcagcatcgaggacagggccaggatgagg
cagagccagcggcgcagccggcaccgcagagccagcaaggagggcaaggacacggctggc
atcttggggagccgctcggccagccaggagatggggctggaggaggccagcaccgtggag
ggggcacaggacggggaccggcgtggggacgtggctgcagcagaggcgctgattccgggg
gagccagaggcgagcggggagtccatcaggacaaacggggtccctgctggcgatgccgat
ctgattgggagcgccaagaaggggagccccccacacgccggaactgagctctcccagggg
aagacgggcaacctgatggagcaggactgcagcagcccagacaccagtgagcaggcgctg
ctggagcccagccgcaccgtgagcctcagcgagcccgacctctcctccatcacccccaac
accgagaaggccactgagagcacggccatcatgatcgatgtccacgactccgctgtggta
cagattagcaacaagacagatggtgaagccagccccttaaaggaggctgagaccaaagag
gatgaggaggaaatggagaagaagaagcagaagaaggaaaagagcaaaacgggcaaagcg
atggtgccgcacagctccatgttcatcttcagcaccaccaacccggtgaggagggcctgc
cactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtgatcgccgccagc
agcatcgccctcgccgccgaggatcccgtcctcaccaactccgaccgcaacaaagtcctg
aggtattttgattacgtcttcactggcgtcttcacctttgagatggtgatcaagatgatt
gatcagggcttgatcctgcaggatggctcctacttccgggacctctggaacatcctggat
ttcattgtggtggtgggagcactggtggcttttgccttggcgaatgctttggggaccaac
aagggccgggatatcaagaccatcaagtctctccgtgtgctgcgggtattgaggcccctg
aaaaccatcaagagactgcccaagctgaaggccgtttttgactgcgttgtgacatctctc
aagaacgtcttcaacatcctcattgtctacaagctcttcatgttcatctttgctgtcatc
gccgtgcagctcttcaaggggaagttcttctactgcactgacagctcgaaggacacgcag
aaggactgcatagggaactacgtggaccacgagaagaacaagatggaggtgaaatgccgg
gagtggaagcggcacgagtttcactatgacaatatcatctgggctctgctcaccctgttc
acagtgtccactggcgaggggtggccccaggtgctgcagcactcggtggatgtgacagag
gaggaccgtgggcccagccgcagcaaccgcatggagatgtccattttctatgtcgtctac
tttgtggtcttccctttcttcttcgtcaacatttttgtggctctcatcatcatcacattc
caagagcaaggagacaaaatgatggaggagtgcagtctggagaagaacgagagggcctgt
attgactttgccatcagcgccaagcccctgacgcggtacatgccccagaacagacacacc
ttccagtaccgcgtgtggcacttcgtggtgtccccgtccttcgagtacaccatcatggcc
atgatagcgctcaacaccgtggtgctcatgatgaagtactattctgctccatacacctat
gagctggccctgaagtacctgaacattgccttcaccatggtgttctccttggagtgcgtc
ctcaagatcattgctttcggcttcctgaattatttccgggacacctggaacatatttgac
ttcatcacggtcatcggcagcattacagagatcatcctgacggacaccaagctggtgaac
accagcagcttcaacatgagcttcctgaagcttttccgggctgctcggctcatcaagctg
ctccgccagggttacaccatccgcatcctgctctggacgtttgtgcagtccttcaaggca
ctcccctatgtctgcctcctgattgccatgcttttcttcatctatgccatcattgggatg
caggtttttggcaatatcaaactagatgaggaaagccacattaaccggcacaacaacttc
cgcagcttcttgggctccctcatgctcctcttcaggagtgccaccggagaggcgtggcag
gagatcatgctgtcctgcctggagggcaaaggctgcgagccggacacgacggcgacatcc
gggcagaatgagaacgagcgctgcggcaccgacctggcctacgtttactttgtgtccttc
atcttcttctgctccttcctgatgctcaacctgtttgtggcagtcatcatggacaacttt
gaatacctgacacgggattcctccatcctgggccctcaccatctggatgagtttgtccgg
atctgggcagagtatgaccgagcagcgtgtggccgaatccattacactgagatgtatgaa
atgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcc
tataagcctggtcgatgtgtttttcgatattgttttccgtccgctgttttcttctctctc
ttgcgcagagactggtgctga

DBGET integrated database retrieval system