KEGG   Corvus cornix (hooded crow): 104693603Help
Entry
104693603         CDS       T03546                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00590  Arachidonic acid metabolism
ccw01100  Metabolic pathways
ccw04370  VEGF signaling pathway
ccw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104693603 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104693603 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104693603 (PTGS2)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104693603 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 104693603
NCBI-ProteinID: XP_010404643
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MTAGPDRYECDCTRTGYYGQNCTTPEFFTWLRLVLKPSPNTVHYILTHFQGAWNIINNIP
FLRDTIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVK
GKKELPDSSLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKRGPAFTRALGH
GVDLNHIYGETLERQLKLRLRKDGKLKYQMIDGEMYPPTVRDTQAEMLYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDVLKRQHPDWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFRIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFRSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNTASLQKLICNNVKGCPFTAFHILPPE
PTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggggcccgatcgctacgagtgcgactgcaccaggacaggctactacgggcag
aactgcaccactccggaattcttcacgtggctgaggctagtgctgaaaccatcaccaaac
actgtccactacatcctcacccacttccaaggagcctggaatatcatcaacaacattccc
ttcttacgggacactattatgagatatgtactaacatcaagatcacacttgattgacagc
ccaccaacttacaatagtgactacagttacaaaagctgggaagcttattccaatctttcc
tactacacaagaagccttccaccagtaggacttgactgcccaacaccgatgggtgttaaa
ggtaagaaagagctcccagattcaagtctgatcgtggagaagtttttgctgaggaggaag
tttattcctgacccacaaggcacaaacgtgatgttcacgttctttgcccagcacttcacg
caccagttcttcaaaacggaccacaagaggggccctgccttcaccagagcgctcggccac
ggggttgacttgaaccacatttatggagagactctggagagacaacttaaactgagactt
cgaaaggatggaaagctgaaataccagatgatcgatggagaaatgtacccgccgacggtg
agggacacgcaggcagagatgctgtacccaccccacgtgcccgagcacctgcagttctcc
gtggggcaggaggtgttcggtctggtgccggggctgatgatgtacgccacgatctggctg
cgcgagcacaaccgcgtctgcgacgtgctcaagcgccagcaccccgactgggacgacgag
cagctcttccagaccacccggctcattctgataggagagacaatcaagattgttatagag
gactacgtgcagcacctgagtgggtaccacttcaagctgaagtttgaccccgagctgctg
ttcaaccagaggttccagtaccagaaccgcatcgcagccgagttcaacaccctgtaccac
tggcacccgctgctgcctgacaccttccgcatccacgaccaggagtacaccttccagcag
ttcctctacaacaactccatcatgctggagcacggcctctcccatatggtcaaatctttc
tccaagcaaagtgctggcagggttgctggtgggaagaacgttcctgctgcagtacagaaa
gtggcaaaggcctccattgaccaaagcaggcagatgaggtaccagtccttgaacgagtac
aggaaacgcttcatgctgaaaccgttccgatccttcgaagagcttacaggagaaaaagag
atggcagcggagctggaggagctgtacggggacatcgatgccatggagctgtacccaggc
ctgctggtggagaagccccggcctggggccatctttggcgagaccatggtggagatcggg
gcgccgttctccctgaaggggctgatgggcaacgccatctgctcccctgagtactggaag
cccagcaccttcgggggcaaggtgggcttcgacatcgtcaacacggcctccctgcagaag
ctcatctgcaacaacgtgaagggctgtcccttcactgccttccacatcctgcctcctgag
cccaccgaggccacgattaacgttagtacctcaaaaactgccatggaagatatcaacccc
acgctcctgctgaaagagcgctctgcagagctgtag

DBGET integrated database retrieval system