KEGG   Corvus cornix (hooded crow): 104693887Help
Entry
104693887         CDS       T03546                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00250  Alanine, aspartate and glutamate metabolism
ccw00410  beta-Alanine metabolism
ccw00430  Taurine and hypotaurine metabolism
ccw00650  Butanoate metabolism
ccw01100  Metabolic pathways
Module
ccw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    104693887 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104693887 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104693887 (GAD1)
   00430 Taurine and hypotaurine metabolism
    104693887 (GAD1)
Enzymes [BR:ccw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104693887 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104693887
NCBI-ProteinID: XP_019146061
LinkDB All DBs
Position
Unknown
AA seq 563 aa AA seqDB search
MLGSEKTLTCAPCNNNVGFLQRTNSLEDKGRIVSSLKERQSSKSLLACENSEKESRFRRT
ETDFSNLYARDLLPSKNGEEQTMQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGM
EGFNLELSDNPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANT
NMFTYEIAPVFVLMEQITLRKMREIIGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEV
KTKGMAAIPKLVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILEA
KEKGYVPLFVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLN
GIERANSVTWNPHKMMGVLLQCSAILVREKGILQGCNQMCAGYLFQPDKQYDVSYDTGDK
AIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYTKIKNREEFEMVFEGEPEHT
NVCFWYIPPSLRGMPDSDERREKLHRVAPKIKALMMESGTTMVGYQPQGDKVNFFRMVIS
NPAATKSDIDFLIEEIERLGQEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagtgagaaaactctgacctgtgcaccttgcaataataatgtagggttcctg
caaaggaccaacagcctggaagacaaaggccggatcgtcagctctctcaaggaaaggcag
tcctccaagagcctgctggcatgcgagaacagtgagaaggaatccaggttccggcgcacc
gagacagacttttccaatttgtatgccagagatttgttgccctccaagaatggtgaggag
cagaccatgcagttcctgctggaggttgtggacatcctcctcaactacgtgaggaagact
tttgacagatccaccaaagtgctggacttccaccacccgcaccagctcctggagggcatg
gagggcttcaacctggaactttcggacaaccctgagtccctggagcagattctggtggat
tgtcgggacacactgaaatatggagtgaggacaggtcatcctcgctttttcaatcagctg
tccacaggactggacattattggcttggctggggagtggctgacatcgactgctaataca
aacatgtttacctatgaaattgcccctgtttttgtcctcatggaacaaataacactccga
aagatgagggagattattggatggtcaaataaagatggtgatggaatattctcacctgga
ggagcaatctccaacatgtacagcataatggctgcacgctacaagtatttccctgaagtt
aaaaccaaaggcatggctgcgatccctaaactggttctctttacctcagagcatagtcac
tactcaataaagaaagctggagctgcgcttggatttggaacagacaatgttattttgata
aaatgcaatgaaagaggcaaaataataccagctgatttggaggcaaaaattctggaagca
aaagaaaagggatacgttcctctttttgtaaatgcaactgcaggcacgacagtatatgga
gcctttgatccaatacaggagattgcagatatatgtgaaaaatacaacctctggctccat
gtagatgctgcctggggaggtggactcttaatgtcccgaaagcaccgtcataaattgaat
ggaatagaaagagccaactcagtcacttggaatccacacaagatgatgggagtgttgtta
caatgttctgccatacttgtccgggagaagggtatccttcaaggctgcaatcaaatgtgt
gcaggctatctcttccagccagacaaacagtatgatgtctcctatgacactggagataaa
gcaatacagtgtggtcgacatgtggacatttttaaattctggttgatgtggaaagcaaag
ggtacagtaggatttgaaaatcagatcaataaatgcctggagctggcagaatatctctat
actaaaataaaaaacagagaagaatttgagatggtttttgaaggggagccagagcataca
aatgtatgtttttggtatattcctccaagtctcaggggcatgccagactctgatgagaga
agagaaaagttgcacagggtggcaccaaaaatcaaggcattgatgatggagtcaggtacc
accatggttggatatcagcctcagggtgataaagtcaacttcttccgaatggtcatctca
aacccagcagctactaagtctgacattgactttctcattgaggaaattgagagattgggg
caggagctgtag

DBGET integrated database retrieval system