KEGG   Corvus cornix (hooded crow): 104693898Help
Entry
104693898         CDS       T03546                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04068  FoxO signaling pathway
ccw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104693898 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104693898 (SOD2)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104693898 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 104693898
NCBI-ProteinID: XP_019146580
LinkDB All DBs
Position
Unknown
AA seq 176 aa AA seqDB search
MQLHHSKHHATYVNNLNVAEEKYKEALAKGDVTTQVSLQPALKFNGGGHINHTIFWTNLS
PNGGGEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACAN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYATCKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcatcatgctacctatgtgaacaacctgaacgttgccgag
gagaaatacaaagaggcactggcaaaaggtgatgttacaactcaggtgtcacttcagcct
gcactgaagttcaatggtgggggtcatatcaatcacaccatcttctggacaaacctttct
cctaatggagggggggagcctaaaggagagctgatggaagccatcaagcgtgactttggt
tcctttgcaaacttcaaggagaagctgacagctgtatcagtcggtgttcaaggatcaggc
tgggggtggcttggctataacaaggagcaggggcgcctacagatagcagcttgtgcaaat
caagaccctttgcaaggaacaacaggtctcattcctttgctaggcattgacgtatgggaa
cacgcttattatcttcagtataaaaatgttcgacctgattatttgaaagccatctggaat
gtgatcaactgggagaatgtatcttcaagatatgcaacttgcaaaaagtag

DBGET integrated database retrieval system