KEGG   Corvus cornix (hooded crow): 104695072Help
Entry
104695072         CDS       T03546                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00562  Inositol phosphate metabolism
ccw01100  Metabolic pathways
ccw04068  FoxO signaling pathway
ccw04070  Phosphatidylinositol signaling system
ccw04115  p53 signaling pathway
ccw04140  Autophagy - animal
ccw04150  mTOR signaling pathway
ccw04218  Cellular senescence
ccw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104695072 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104695072 (PTEN)
   04070 Phosphatidylinositol signaling system
    104695072 (PTEN)
   04150 mTOR signaling pathway
    104695072 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104695072 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    104695072 (PTEN)
   04218 Cellular senescence
    104695072 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104695072 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccw01009]
    104695072 (PTEN)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104695072 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     104695072 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104695072 (PTEN)
Protein phosphatases and associated proteins [BR:ccw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104695072 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 104695072
NCBI-ProteinID: XP_010406940
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLRAQEALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSSGTCNPQ
FVVYQLKVKIFTSPSGPSRREDKYMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFW
VNTFFIGLDENSDKVENGSLVADQELDGIFSTERSDNDKEYLILTLTKNDLDKANKDKAN
RYFSPNFKVKLFFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggctttcctgcggagaggcttgaaggagtgtaccggaacaacattgatgatgtagta
aggtttttggattcaaagcataaaaaccattacaagatatacaatctatgtgctgaaaga
cattatgacaccgccaaatttaactgcagagttgcacagtacccttttgaagaccataac
ccaccacagctggagctcatcaaacctttttgtgaagatcttgaccagtggctaagtgaa
gatgacaatcatgtggcagcaatccactgtaaagctggaaagggacgaactggtgtaatg
atttgtgcatatttgttgcatcgaggcaagtttttaagggcccaagaagccctggatttc
tatggggaagtaaggaccagagacaagaagggagtgacaattcccagtcagagacgctac
gtgtactactatagctacctgttaaagaaccacctggattacagaccagtggcactgctg
ttccacaagatgatgtttgaaacaattcccatgttcagcagcggaacttgcaatcctcag
tttgtggtgtaccagctaaaggtaaagatattcacctccccttcaggaccctcacgacgt
gaagacaagtacatgtactttgaattccctcaacctttgccggtatgcggtgatatcaaa
gtggaatttttccacaaacagaacaagatgttgaaaaaggacaaaatgtttcacttttgg
gtaaatacattcttcataggactggatgaaaattcagacaaagtagaaaatggaagtcta
gttgcagatcaggaacttgatggtattttcagtacagagcgctcagataatgataaggaa
tatttaatccttacattaacaaaaaacgatctagacaaagcaaataaagacaaagccaac
agatacttctctccaaacttcaaggtgaagctatttttcacaaaaacagtagaagagcca
tcaaacccagaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacct
gatcattatagatactctgacaccactgactctgatccagagaatgaaccttttgatgaa
gatcagcatacgcagattacaaaagtctga

DBGET integrated database retrieval system