KEGG   Corvus cornix (hooded crow): 104695389Help
Entry
104695389         CDS       T03546                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104695389
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     104695389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 104695389
NCBI-ProteinID: XP_019147439
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MQILLLLLAAAGLCWGQYNPNTLPKRTSIVHLFEWRWQDIALECERYLAPNGFGGVQVSP
PNENIVITNPNRPWWERYQPISYKLCTRSGNEQEFKDMVTRCNSVGVRIYVDAVVNHMCG
AAGGSGTHSTCGSHFNAGNRDFPAVPYSGWDFNDGKCHSGSGDIENYGDIYQVRDCRLVS
LLDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDAAKHMWPGDIRAFLDKLKDLNTQWFPE
GTKPFIYQEVIDLGGEPIKGSEYFGNGRVTEFKYSAKLGTVIRKWDGEKMAYLKNWGEGW
GFVPSDKALVFVDNHDNQRGHGAGGASVLTFWDARLYKMAVGFMLAHPYGFTRVMSSFRW
PRYFENGKDINDWVGPPSNSDGSIKPVTINADTTCGNDWVCEHRWRQIKNMVIFRNVVDG
EPFSNWWDNGSNQVAFGRGNKGFIIFNNDDWNMNVYVQTGLPAGTYCDVISGQKEDNKCT
GKQVFVSSDGMANFQINTDAEDPFIAIHVDAKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcctcctcctcctccttgcagctgcagggctttgctgggggcagtacaacccc
aacactctgcccaagagaacatctatcgtgcatctctttgaatggcgctggcaggatatt
gctctggagtgtgaacgctacttagctcctaatggatttggaggagttcaggtttcacct
ccaaatgaaaatattgtcattactaacccaaacagaccctggtgggaaagataccagcca
attagctacaaactctgcactcgatcaggaaatgaacaggaattcaaagatatggtgacc
agatgcaacagtgttggggttcgtatctatgtggatgctgtcgtcaaccatatgtgtggg
gctgcaggtggctcaggcacacattctacctgtggaagccattttaatgccggaaacaga
gattttccagctgtaccatactctggctgggatttcaatgatggcaaatgtcacagtgga
agtggagatattgaaaattatggtgatatatatcaggtccgggactgccgcttggtcagc
cttctggatctggccctggagaaggactatgtgcgctccaaggttgctgagtacatgaac
catctcattgacatcggcgtcgcaggattccggatcgatgctgccaagcacatgtggcct
ggggacataagagcatttctggacaagctgaaagatctaaatactcaatggtttcctgaa
ggaactaaacctttcatttaccaggaggtaattgacttgggtggagagcccatcaaaggc
agcgagtactttggaaatggccgagtgacagaattcaaatacagtgccaaactggggaca
gtgatccgcaagtgggacggagaaaagatggcctacttaaagaactggggagaaggctgg
ggctttgtgccttccgacaaagccctggtctttgtggataatcacgacaaccagagaggg
catggggccggcggagcttctgttctgaccttctgggatgccaggctctataaaatggca
gttggtttcatgcttgctcatccgtatgggttcacacgtgtgatgtcaagttttcgctgg
ccaagatattttgaaaatggaaaggacatcaatgactgggttggacccccaagtaactcg
gatggctccataaagcccgttacaatcaacgcggacacaacctgtggcaacgactgggtt
tgtgaacatcgctggcgtcagataaagaacatggttatcttccgtaatgtggtggatggt
gagcctttctccaactggtgggacaatggcagcaatcaagtagcttttggccgcggtaat
aaaggtttcatcatcttcaataatgatgactggaatatgaatgtctatgtgcaaactgga
ctgcctgctggtacctactgtgatgttatttctggacaaaaggaggacaacaaatgtact
ggaaagcaggtttttgtttctagtgatggaatggctaatttccagattaataccgatgct
gaagatccatttattgcaattcatgttgatgccaaattataa

DBGET integrated database retrieval system