KEGG   Corvus cornix (hooded crow): 104696143Help
Entry
104696143         CDS       T03546                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
ccw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104696143 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    104696143 (GYS2)
Enzymes [BR:ccw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104696143 (GYS2)
Glycosyltransferases [BR:ccw01003]
 Polysaccharide
  Storage polysaccharide
   104696143 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 104696143
NCBI-ProteinID: XP_010408596
LinkDB All DBs
Position
Unknown
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFCEPPNPAIKKAMDTMKSQGCQAFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPSIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDITIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRAFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSASQHSSPHHSEA
EDEDEDERYDEDEEAERDRQNIKSPFTLGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcaagatccctgtccatgacatctctgaacgggcttcctcagtgggaggat
gaagacctgcccgtggaggatttgttactctttgaaatttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatggggc
gaaaactatttcctgattggcccctattttgagcagaatgtgaagactcaggtggaattc
tgtgagcctccaaaccctgcaattaagaaggcgatggacaccatgaaaagccaagggtgt
caggccttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagtcagcaacata
ggaatcccttttcatgaccgagaagccaatgatgctgtgatttttggatcattaacagcc
tggtttttaaaagagctttcctgtcagtttgatgacaagcccagtataattgcccacttc
cacgagtggcaggcaggagtgggtttaatcctgtctcgatcgcagaaacttcccgtcgcc
acaatttttactacacatgcaactctgcttgggagatacctctgtgcagccagtattgac
ttctacaacaatctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggaacgggcatctgtgcattgtgcccacgtgttcaccacagtgtcc
cagatcacagctacagaagcagaacatatgcttaaaaaaagccctgatgttgtcacacca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccacctcgacttcaat
cttgacaaaaccttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgat
gttacagttgttgtgttcttcatcatgccagcaaagaccaacaatttcaatgtggaaacc
ctgaagggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaggaaactctacaatgccctgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataaccattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaatgacccaatcctcaacacc
atccggcgcattggcctgttcaacaaccgcacagaccgcgtgaaggtgatcttacatcca
gagtttctttcttcaacaagccccttgctgcccttggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgagccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggatttggctgtttcatgcag
gaacatgttgctgacccagcagcctatgggatctacatcgtggacaggaggttccgctcg
ccagacgagtcgtgcaaccagctgacccagttcctgtacggcttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcaccgagcggctctcggacctcctggactggaga
tacctgggcaggtattacatgcatgccagacacttggccctcagcagagcattcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggcttcaggttccccaggcct
tcatcagtgccaccatcgccttctgcctcccagcattccagccctcaccacagtgaagct
gaggatgaagatgaagatgagagatacgatgaggatgaggaagctgaaagggataggcag
aacatcaagtccccctttacccttggagccttgccacaagggaaaaagaagcagcacgga
gaatacaggaactga

DBGET integrated database retrieval system