KEGG   Corvus cornix (hooded crow): 104697629
Entry
104697629         CDS       T03546                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04068  FoxO signaling pathway
ccw04110  Cell cycle
ccw04115  p53 signaling pathway
ccw04218  Cellular senescence
ccw04310  Wnt signaling pathway
ccw04340  Hedgehog signaling pathway
ccw04371  Apelin signaling pathway
ccw04510  Focal adhesion
ccw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104697629 (CCND1)
   04340 Hedgehog signaling pathway
    104697629 (CCND1)
   04371 Apelin signaling pathway
    104697629 (CCND1)
   04068 FoxO signaling pathway
    104697629 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104697629 (CCND1)
   04115 p53 signaling pathway
    104697629 (CCND1)
   04218 Cellular senescence
    104697629 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104697629 (CCND1)
   04530 Tight junction
    104697629 (CCND1)
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 104697629
NCBI-ProteinID: XP_019149263
LinkDB
Position
Unknown
AA seq 153 aa
MELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRKHAQTFVALCATDIKFISNP
PSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCDPDCLRACQEQIESLLESSL
RQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgat
ttcattgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgt
aaacatgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaaccca
ccctccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaac
actaacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgt
gatccggattgtttacgagcctgccaagaacagattgagtccctcctcgagtccagtcta
cgccaggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagac
ctctcctgcacgcctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system