KEGG   Corvus cornix (hooded crow): 104697761
Entry
104697761         CDS       T03546                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04068  FoxO signaling pathway
ccw04217  Necroptosis
ccw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104697761 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104697761 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104697761 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccw03000]
    104697761 (STAT3)
Transcription factors [BR:ccw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104697761 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 104697761
NCBI-ProteinID: XP_010411084
LinkDB
Position
Unknown
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAESNAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctacagcagctcgacacgcggtacctggagcagctccaccag
ctctacagtgacagcttccccatggagctccgacagttcctggccccctggattgaaagc
caggactgggcatacgctgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgctttctgcaggagtccaatgtcctctaccag
cacaacctgcgccgcatcaagcagttcctgcagagcagatacttggagaagccaatggaa
atagcccgcatcgtggctcgctgcctctgggaagagtcccggctcctccagactgctgcc
actgcagcccagcaagggggacaggcaacacatccaacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgatttcgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaacgggaacaaccagtcggtgacccggcagaagatg
cagcagctggagcaaatgctgacggcactggaccagatgcgcaggggcatagtgagcgag
ctggctgggctgctgtcagccatggaatatgtgcagaagatgctggcagatgaggaactg
gcagactggaagaggcggcagcagattgcctgcatcggtggcccgccaaatatctgtctg
gaccggcttgagaactggataacctctcttgctgaatcgcagctacagacccggcaacag
atcaagaagttggaagaactgcagcaaaaagtatcctataagggtgacccaattgtccag
caccggcccatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagcgct
tttgtcgtggagaggcagccctgcatgcccatgcaccccgaccggcccctcgtcatcaag
acaggagtgcagttcaccaccaaagtcagattattggtcaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggggatgttgcagcacttaggggg
tcccggaagtttaacatcctggggaccaacaccaaggtcatgaacatggaggagtcaaac
aatggcagcctctcagcagagttcaagcacctgaccctgcgggagcagcgctgtgggaat
ggaggccgagccaactgtgacgcctcgctgatagtcactgaggagctgcacctcatcact
tttgagacagaggtgtatcaccaggggctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccacccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacgaagcgtggcctc
agcattgagcagctgaccacgctggcagaaaaactgctgggaccaggcgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgatttggtgaagaagtacatcctggcgctgtgg
aatgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccggggacctttctgctgcgcttcagtgagagcagcaaggaaggtggcatcacc
ttcacgtgggtggagaaggacatcagtgggaaaacgcagatccagtcggtggagccttac
accaagcagcagctgaacaacatgtcgtttgcggagatcatcatgggctacaaaatcatg
gatgccaccaacatcctggtgtccccactggtgtacctgtacccagacatccccaaggag
gaggcgtttggaaagtactgccgctccgagagccaggaacactcggaagcgacggactca
ggtagtgctgctccatacctgaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccgcgcaccctggactcactcatgcagttcggcaac
agcagcgagggcgcagagagcaacgcgggcgggcagtttgagtcgctgaccttcgacatg
gagctgaccccagagtgtgcgtcctcgcccatgtga

DBGET integrated database retrieval system