KEGG   Corvus cornix (hooded crow): 104697877Help
Entry
104697877         CDS       T03546                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00480  Glutathione metabolism
ccw00980  Metabolism of xenobiotics by cytochrome P450
ccw00982  Drug metabolism - cytochrome P450
ccw00983  Drug metabolism - other enzymes
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104697877
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104697877
   00982 Drug metabolism - cytochrome P450
    104697877
   00983 Drug metabolism - other enzymes
    104697877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccw02000]
    104697877
Enzymes [BR:ccw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104697877
Transporters [BR:ccw02000]
 Other Transporters
  Pores ion channels [TC:1]
   104697877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C_2 GST_C GST_N_2 GST_N GST_C_5 Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 104697877
NCBI-ProteinID: XP_020439444
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
TDEVTVFHHGVGWTGAELSLSGSCFFYSFSHEVININLKNKPEWYFEKNPAGLVPVLETS
KGQLICESPITCEYLDEAFPGKKLMPSDPYERACQRMLLEDFSKITSLLFKHVLAVKDGQ
DTTALKAEIAEKFGKLEEVLSKRNTVFYGGDSVSMVDYMIWPWFERLEAFQLKDSLNHAP
KLQRWVEAMKEDPAVKATITDPQTFKNYLQLYLKNSPEACDYGL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
actgatgaggtgactgtgtttcaccatggtgtggggtggactggagcagaactgagcctg
tctgggtcttgtttcttttactcttttagccatgaagtaatcaacatcaatctgaagaac
aaacctgagtggtactttgagaagaaccctgctgggctggttcctgttctggagaccagc
aagggccagctgatctgtgagtccccaatcacttgtgagtatttggatgaggcatttcca
gggaagaagctgatgccttcagacccatatgagcgagcctgtcagaggatgctcttagaa
gacttctcaaagataacatccttgcttttcaagcatgttttggcagtcaaagatggacag
gacaccacggcactgaaagcagagattgctgaaaagtttggcaaacttgaagaggttctg
tccaaacgcaacacggtattttatggtggggactcagtctcaatggttgactacatgatc
tggccgtggtttgaacgtctggaagcattccagctgaaagactctttgaatcacgcccca
aagctccaacgctgggtggaggccatgaaggaggaccctgctgtcaaggctacaataact
gacccgcagacattcaaaaactacctccagctgtatttgaagaacagccctgaggcatgt
gattatgggctctga

DBGET integrated database retrieval system