KEGG   Corvus cornix (hooded crow): 104698238Help
Entry
104698238         CDS       T03546                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00052  Galactose metabolism
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
ccw04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104698238 (GAA)
   00500 Starch and sucrose metabolism
    104698238 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104698238 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccw04147]
    104698238 (GAA)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104698238 (GAA)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104698238 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 104698238
NCBI-ProteinID: XP_019135233
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MSIRVPPQHWCPSSVPPSRLLAGVSLSLCRLNTTVAPLFFTDQFLQISTSLPSHFISGLG
EHLTPLVLDTAWTRVTLWNRDMAPAPHVNLYGSHPFYLVMEDDGSAHGVFLLNSNAMDVL
LQPSPALTWRTTGGILDFYIFLGPDPKSVVRQYLDVVGFPFMPPYWGLGFHLCRWGYSST
DITRQVVANMTAARFPLDVQWNDLDYADAKRDFTFNKKSFKDYPEMVRDFHSRGLRYIMI
VDAGISSSGPPGTYKPYDEGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETHEWWHD
MVKDFHEQVPFDGMWLDMNEPSNFVEGSQDGCPNNNLEHPPYVPGVFGGRLQAGTICASS
QQYLSSHYNLHSLYGLTEAIASHNALLRVRGKRPFIISRSTFAGHGRYAGHWTGDVGSDW
EQLYYSIPEVLLFNLFGVPLVGADICGFVGDTNEELCVRWTQLGAFYPFMRNHNDHGTRV
SPRSPHPDRQGAGPSWGLM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccgtgtccctccccagcactggtgccccagctccgtgcctccctcccggctg
cttgctggagtctccctttctctctgcaggctgaacaccacggtcgcacccctcttcttc
acagaccagttcctgcagatctccacctccctgccctcccatttcatttcggggctgggg
gagcacctgacaccactggtccttgacacagcgtggaccagggtcaccctctggaatcgg
gacatggcacccgcgccccacgtcaacctctacggctcccaccctttctacctggtgatg
gaggacgatggctcagcccacggtgtctttctgctgaacagcaacgcgatggacgtgctc
ctgcagcccagcccggccctgacctggcgcacgactggggggatcctggacttctacatc
ttcctgggccccgaccccaagagtgtggtgcggcagtacctggatgttgttgggttcccc
ttcatgcccccgtactggggcctgggcttccacctctgccgctggggctactcctccacc
gacatcacccggcaggtcgtggccaacatgacagcagcccgcttccccctggacgtgcag
tggaacgacctggattatgccgatgccaagagggatttcaccttcaacaagaaaagcttt
aaggactacccagagatggtgcgggacttccacagccgtgggctgaggtacatcatgatt
gtggatgccgggatcagcagctcagggcccccgggcacctacaagccctacgacgagggc
ctgaagcgaggggtgttcatccgaaacgccacggggcagcccctgattgggaaggtctgg
ccaggccccacggccttcccagacttcaccaacccggagactcacgagtggtggcacgac
atggtgaaggacttccacgaacaagtgcccttcgatggcatgtggcttgacatgaatgag
ccgtcgaacttcgtggagggctcccaggatggctgccccaacaacaacctggagcatccc
ccctatgtgccaggagtgtttggggggcgcctgcaagctgggaccatctgtgcctccagc
cagcagtacctgtcctcccactacaacctgcacagcctgtatgggctgaccgaggccatc
gcctcccacaatgctctgctgagggtccgaggcaagcgccccttcatcatctcacgctcc
accttcgctgggcacgggcgctacgccgggcactggacaggggacgtgggcagcgactgg
gagcagctctactactccataccagaggtgctgctcttcaacctcttcggggtgccgctg
gtgggtgccgacatctgcggcttcgtgggcgacacgaacgaggagctgtgcgtgcgctgg
acccagctgggcgccttctaccccttcatgcggaaccacaatgaccacggcacccgggtg
agccccaggagccctcaccctgacaggcagggggctgggccgagctgggggctgatgtag

DBGET integrated database retrieval system