KEGG   Corvus cornix (hooded crow): 104698430
Entry
104698430         CDS       T03546                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104698430 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104698430 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccw04052]
    104698430 (KITLG)
Cytokines and growth factors [BR:ccw04052]
 Growth factors
  Growth factors (RTK binding)
   104698430 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 104698430
NCBI-ProteinID: XP_010412102
LinkDB
Position
Unknown
AA seq 321 aa
MAMANPELPPRLCAPLQRLLRWEHRGPGFLFLVSVFFFTEQTWIITCFCLQLLLLNPLVK
AQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNL
LQKFSDISDMSDVLSNYLIINNLTRIINDLMACLAFDKNKDFVKENGHLYEEGHFIPEDF
FRHFNSTIEVYKESADRLDRNDCILPSTVETSVNDSRVAVTKTFLFPPVAASSLRNDSIG
SSTSSNKEALGFISSSSLQGISIALTSLLSLVIGFILGAIYWKKIHPKSRPESDETTQCH
DYQEENEISMLQQKEKEHLQV
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcaatggcaaacccggagctgccacctcggctgtgcgcgccgctgcagcggctgctg
cgctgggaacaccggggaccgggtttcttgtttcttgtttctgttttcttttttactgaa
cagacttggattatcacttgcttttgtcttcaactactcctacttaatcctcttgtcaaa
gcccagagttcctgcgggaatccagtcacagatgatgtgaatgacattgcaaaattggtt
ggaaatctcccaaatgattatatgataacccttaaatatgtcccgaagatggatagtctg
cctaatcactgttggttgcatttgatggtgcctgaattttcaaggagtctacataatctt
ctccagaaattctcagatatttcagatatgtcagatgttttaagcaactatttaatcatc
aataatctcacaaggataattaatgatcttatggcatgccttgcttttgataaaaacaag
gattttgtaaaagaaaatggtcacctttatgaagaaggtcacttcattcctgaggatttt
tttaggcactttaatagtaccattgaggtctacaaagagtctgcagacagattggatagg
aatgactgcattttgccttcaacagtagaaacatcagtgaatgattccagagtcgctgtc
acaaaaacatttttgtttcctcctgttgctgccagctctcttaggaatgacagcattggc
agtagcactagcagtaacaaagaagcacttggcttcattagcagctccagcctgcaaggg
atcagcatagcactgacatcattgctgtctctcgttattggctttattttgggagccata
tactggaagaaaatacatcccaaatccagaccagaaagtgatgaaactacacagtgtcat
gactatcaagaggaaaatgagataagtatgttgcagcaaaaagaaaaggagcatctacag
gtgtag

DBGET integrated database retrieval system