KEGG   Corvus cornix (hooded crow): 104698524Help
Entry
104698524         CDS       T03546                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04210  Apoptosis
ccw04625  C-type lectin receptor signaling pathway
ccw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104698524 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104698524 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104698524 (MAP3K14)
   04672 Intestinal immune network for IgA production
    104698524 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccw01001]
    104698524 (MAP3K14)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104698524 (MAP3K14)
Protein kinases [BR:ccw01001]
 Serine/threonine kinases: STE group
  Other
   104698524 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 104698524
NCBI-ProteinID: XP_010412210
LinkDB All DBs
Position
Unknown
AA seq 938 aa AA seqDB search
MAVMGIACQGAPDPADKHKKELTAAEGLKETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSSRSDSLDQIPNN
VAHATEGRMAPTWRGRHRGRAKKKRHKKRSKLKGQPLAAGRRSPRTPEQESCTPIPVQED
ESHQSTLYRNSFWVPEFNKDLGYDPLSFEKPDRVLSTGKLHSPRSQYKTELHKLISPIQC
LNHVWKQRDTVPQPETLHPFPYNILPPHFPHVDNPLHAMKWNALDTYFHGDLNYQDSRLS
GLNLEYNFTKCINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLEPK
EQFHEASENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAA
KKVQVEHFRAEELTTCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLP
EDRALSYLGQVLEGLEYLHAENILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGK
CLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKI
AKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTSVALEEVGGVRSPWKGE
YREPRHLSLSKENSAQTSLSPTVSPVSETGSGPKLSVKVSCASPVLPPPSLEQTEEVEGT
HWNEGKELPETCDPPPLSSTPLPLKSCSHVERATTISEQELQQLEIELFLNSLSQPYSLE
EQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQADGQSCSWNNLLSRS
RHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQPV
HYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgcatgccaaggagctcctgatccagccgacaagcacaagaag
gagctcacggctgctgaggggctgaaagagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgcccacagtaaacgttacagcagccgctcggacagtctcgatcagatccccaacaat
gtggcccatgccacggaggggaggatggcacccacctggagagggaggcaccgaggcagg
gccaagaagaaacggcacaagaaaagatccaagctgaaaggacagcctttggctgctggc
aggagaagtccaagaactccagaacaggagagctgcaccccaattcctgtccaggaggat
gaatcacaccaaagtactctttatagaaacagtttttgggttcctgaatttaacaaggac
ttgggctatgatccactgtcttttgagaagcctgacagagttttgtccactggcaaactc
cattccccaaggagccaatacaaaactgaactgcacaagctgatcagccctattcagtgc
cttaatcatgtttggaaacagagggacactgttccccagcctgagactctccatcctttt
ccctataacatccttcccccccatttcccacatgtggacaatcctctccatgccatgaaa
tggaatgctctggacacatacttccatggtgacctcaactatcaagacagtcgcttatct
ggcctaaacctagaatacaatttcaccaaatgcatcaaccagtctgtgcaaaccagttca
gacaagctttctgtggaagaatatttggtagatgccttgaaggggagtgtgagttttggt
gaaccacaaaatttagccagcctggccaaaacgtggagaggaggtgggctggagccgaag
gaacaattccacgaagcgagtgaaaatgaaggcgtgctgctgaacgagaagctgaagccg
gtggattacgagtaccgagaagaggttcactggaccaagtgccatggttccttgggcatt
ggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcagtgtgctgcc
aagaaggtgcaggtggaacacttccgtgccgaggagctgacgacgtgcgcggccgtgacg
agccccagcgtggtccccctgtacggcgccgtcaaggagggcccctgggtgaccatcttc
atgaagctgatggagggtggctcattagggcagctcattaaacagagtggctgcctgcca
gaggacagagccctcagctacctgggccaggtgttagagggtctggagtatcttcatgct
gaaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcagacgatgggagc
agggccctcctgtgtgactttggccactctgctcacctacacccggacgggctgggaaag
tgcttggtcacagggaactacgtgcctggcacagaaacccacatggccccggaggtggtg
atggggaagcgctgtgactccaaggtggacgtgtggagcagctgctgcatgatgctgcac
atgctcaacggctgccacccctggacccagtactacaaccaccccctctgcctgaagatc
gctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgctgag
attattaagctggggctggagaaggagcctctccacagggcatctgcgtcagagctcaaa
actaagaccagtgtggcccttgaggaagtgggaggtgtgagaagcccctggaaaggtgaa
tacagagagcccagacatttatctttgagcaaagaaaacagtgcacagacatccctgtcc
cccacagtgagcccagtttctgagactggttctggcccaaaactgtcagtcaaagtttcc
tgtgccagcccagtcctaccacccccatctctggagcaaacagaggaggttgagggaacc
cactggaatgagggcaaggagttacctgagacctgtgatccccctcctctctcctcaact
cctctgcccctgaagagctgcagccacgtggaaagagccacaaccatttcagagcaagaa
cttcagcagctggaaattgaactgtttctgaacagcctttcccagccttactctctggaa
gaacaagagcaaatgctttcgtgcctcagcatcgacagcccctttgtgtcagatgccagt
gagaagaactccatgaaggcttctcacagcttgagggacaccatgagctctgggatccat
tcctggaacagccaggcagatgggcagagctgcagctggaacaacctgctgagccgcagc
cggcacacggacactcccagctacttcaacggagtgaaaatccagatccagttgctaagt
ggagaaaatttgcacatcagggatttccacaggacaaaggtgggagacattgccacaggg
ataagcagccagatccccgtccctgccttcagcctggtgaccaaggaggggcagcccgtg
cactacgacatggaggtgcctgactctggcatcgagctccagtgcaccctggcccccgac
tgcagcgtcagctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system