KEGG   Corvus cornix (hooded crow): 104698649Help
Entry
104698649         CDS       T03546                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00052  Galactose metabolism
ccw00500  Starch and sucrose metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104698649 (GANC)
   00500 Starch and sucrose metabolism
    104698649 (GANC)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104698649 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 104698649
NCBI-ProteinID: XP_010412370
LinkDB All DBs
Position
Unknown
AA seq 855 aa AA seqDB search
MQPDCFLQVLLQVEIYEIEGNIFRLKIDEASPLRARYKVPDVLIKEPTTQRLFISHKEAG
ILVLSSVNEDYKLQVTANPFQVELQSKGETVMSINSNGLLYFEHLQPPPSDRKPTAQNEE
EASDSSKEKQEDLGLWQEKFGSFLDIKAHGPSSVGMDFSLHGYDHVYGIPQHTETLLLKN
TSDGDAYRLYNLDIFGHKIHDKIGIYGSVPLLLAHKPNRTSGIFWLNSSETLVDISTKAV
AEHTPSRSAAETAKQRAVPLTNVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQALPP
LFSLGYHQCRWNYEDEQDVKAVDAGFDAHDIPYDVIWLDIEHTDGKRYFTWDKQKFQNPR
KMQEHLRKKKRKLVVIVDPHIKVDPSYPLYAQAKDKGYFVKDRSGQDFEGICWPGSSCYL
DFTNPEVRKWYADQFAFKTYKASTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHRE
VHNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISI
PMLLTINMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMESKRREPWLFG
EKNTQIIRKAIRERYVLLPYLYTLFYRAHTAAEPVMRSLWIEFPEKMETFDVENEYMLGN
ALLVHPVTEKEAKTVTVLFPGSEEIWYDFRKFKRMEDVGTMKIPVTLENIPVFQRGGTVI
PLKTTAGKSTEWMIDISYELHVALDTEAYAIGELYVDDGHSFQYLHKKQFLYRKFTFHKN
ILFSSCVDESGQYHTTCVVERVIVLGFGKQPTFVTASSKDGKKKEVVFTYDTKTSAMTLE
NLALSVDADWEICIS
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagattgctttttacaggttcttctacaagtagaaatttatgaaatagaaggc
aatattttcaggcttaaaattgatgaggcatctcctctcagagcaagatacaaagttcct
gatgttcttataaaggaacctaccacccagagactgttcatatcccacaaggaggcaggt
attttggtactatcaagtgttaatgaggactacaaacttcaagtcacagcaaaccccttc
caggttgagctgcagtccaagggtgagactgttatgagcataaattccaatgggttgttg
tattttgagcacctgcaaccacctcccagtgatagaaaacctacagcacaaaatgaggag
gaagcaagtgattcctctaaggaaaaacaagaggatctaggtctctggcaagagaaattt
ggcagtttcttagacatcaaagctcatggtcctagttctgtaggcatggacttctcttta
catggatatgaccatgtttatggaataccacaacacacagaaacacttctcctcaaaaac
accagtgatggcgatgcctaccggctttataatttggatattttcggccacaagatacat
gacaaaataggcatttatggttcagtgccccttctcttagcacacaagcctaacagaact
tcagggatcttctggctgaactcttcagaaacactggtggatattagtacaaaggcagta
gctgagcacactccatccagatctgctgcagagactgctaagcagagagcagtgcctcta
accaatgtacgctggatgtcagaaagtgggatcattgatgttttcctactgatgggaccc
actgcatttgatatcttcaagcagtttgcacaactgacaggcactcaagccttgccccca
cttttttctctgggctaccatcagtgcaggtggaattacgaggatgagcaagatgtcaag
gcagtggatgctggctttgatgcacatgacattccttatgatgtcatatggctggatata
gagcacacggatggcaagaggtattttacttgggataaacagaaattccagaaccccaga
aagatgcaagaacatctcaggaagaaaaaacgcaagcttgtggtcatcgtagatcctcat
attaaggttgatccctcatatcccctgtatgcacaggcaaaagacaagggctattttgtg
aaagacagaagtggacaagattttgagggcatctgttggccaggttcctcttgttacctg
gatttcacaaatcctgaagtgcgaaaatggtatgcagatcaatttgcattcaaaacatac
aaggcatccactaatatcctctttgtatggaatgatatgaatgagccttcagtcttcaag
ggggcagaactaacaatgcagaaagatgctgtgcactacaacaactgggagcatcgggaa
gtacacaacctctacggattctatcagcaaatggcaactgctgaaggactcatcagacgt
tcttcaggaaaagagagaccatttgtcctcacacgatctttctttgctggatcacagaag
tatggggcagtatggactggagacaacacagcagagtggagttacttgaaaatatctatt
ccaatgcttcttaccatcaacatggcagggatttcattctgtggagctgatgtgggaggg
tttattggagatccagaaccagaattacttgttcgctggtatcaggctggagcctaccag
cccttcttcagaggtcattctaacatggagagcaaacggcgcgaaccgtggctctttggg
gagaagaacacccagatcatcaggaaagccattagagagcgctacgtcctcctgccctac
ttatacactctgttctatcgggcacacacggcggctgaacccgtcatgagatctctctgg
atagagtttccagagaaaatggaaacttttgatgtggaaaatgagtacatgctgggaaat
gccttgttggtgcatccagtcacagaaaaagaggccaagacagtgacagttctgtttcca
gggtcagaggagatttggtatgatttcagaaaatttaagcgaatggaagatgtaggcaca
atgaagatcccagtaacactggagaatattccggtattccagcgggggggcactgtgata
cccctgaagaccacagctggaaaatccactgaatggatgatagatatttcttatgagctc
cacgtggccttagacacagaggcctatgccataggtgagctctacgtagatgatgggcat
tcatttcaatatctccacaagaagcagttcctgtatcggaaattcactttccacaagaac
attctcttttccagctgtgtagatgaaagcggacaataccacaccacatgtgtagttgaa
cgggtgatagttctgggatttggaaagcaacccacttttgtgacagccagttccaaggat
gggaaaaaaaaggaagtggttttcacatacgatacaaagacctctgcgatgacactggaa
aacttagccctgagtgttgatgctgactgggagatctgtatcagctga

DBGET integrated database retrieval system