KEGG   Corallococcus coralloides: COCOR_00709Help
Entry
COCOR_00709       CDS       T01780                                 

Gene name
gatA1
Definition
(GenBank) amidase family protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFE08879
UniProt: H8MHD0
LinkDB All DBs
Position
complement(840166..841842)
Genome map
AA seq 558 aa AA seqDB search
MTYRRAPVKAPRLSGMALKAMVNTLERGGVGPALVEKLMRDSGIEQWRELSAGDAPPVQY
PLPPGAPPAETQTPVEQAARAVAASPVTPKRETVSAFARAYRDGSTDPVAVAHKVHEAIE
RLDAGADRLGLFIARKPEEVLRSAEASAERLRAGAPLSVFDGVPVVIKDELDLAGFPTTL
GTTFRTEPARTDSTVAARLKAAGAVILGKANMQEIGINPIGLNPHHGAARNPWNRGHITG
GSSSGSGAVVAAGLCPVSIGADGGGSIRIPAALCGIVGLKATWGRIPETGVPPLCWNVAH
VGPLGLTVDDVAAAYAIVAGPDGHDVVARQQPPHHLSGFEDGALKGIRLGICTPYFEDAD
PDVVARCREAVRALTDAGATVVELPAPDLNTILWTHSCIILSEMAEAMLPQLKARASVFG
LDSRTNLALGRHFRATDLIHALRHRHRLTRELLALMADVDVIVTPTTASTAPAIPEATLP
AGESNLPVVDALMRFIRLANLTGCPALSVPAGFDRAGLPVGVHLMGRPYEEHLLLRLGRV
VERATERRTPGIHVNVLP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccgacgcgctccggtgaaggctccgcgactctctggcatggccctcaaggcc
atggtcaacacgctggagcggggcggcgtgggcccggcactggtggagaagttgatgcgg
gacagcggcatcgagcagtggcgcgagctgtccgctggcgatgctccgcccgtccagtac
ccactgcccccgggagcgcctcccgctgaaacacagacaccggtggagcaggccgcgcgc
gccgtcgccgcgtcacccgtgacgccgaagcgggagacggtctcggcgttcgctcgcgcc
taccgggacgggagcacggatccggtggccgtggcgcacaaggtccacgaggcgattgaa
cggctggacgccggcgcggaccggctggggctcttcatcgctcgcaagccggaggaggtg
ctgcgctcggcggaggcgtccgcggagcgcctgcgcgcgggcgcgcccttgagcgtgttc
gacggggtgcccgtcgtcatcaaggacgagctggacctggccggcttccccacgacgctg
ggcaccacgttccgcaccgagccggcccggaccgactccaccgtggccgcccggttgaag
gccgcgggcgcggtcatcctgggcaaggccaacatgcaggagattggcatcaaccccatc
gggttgaatccgcaccacggcgccgcgcgcaacccgtggaaccggggccacatcaccggc
ggcagctccagcggctccggagccgtggtggcggcgggcctgtgtccggtgagcattggc
gcggacggcggcggctccatccgcatccccgccgcgctgtgcggcatcgtcggcctcaag
gccacctggggccgcatcccggagacgggcgtgccgccgctgtgctggaacgtggcgcac
gtgggccccctgggcctcaccgtcgacgacgtcgcggcggcgtatgcgattgtcgccgga
ccggacggacacgacgtcgtcgcccggcagcagcctccgcatcacctgtctggctttgaa
gacggtgcgttgaagggcatccggctgggaatctgcacgccctatttcgaagacgcggat
ccggacgtggtggcacgctgccgcgaggccgtgcgcgccctcaccgacgcgggtgccacg
gtggtggagctgcccgcgccggacctgaacacgattctctggacgcacagctgcatcatc
ctgagtgagatggcggaggcgatgctgccgcagttgaaggcccgcgcgtcggtgttcggg
ctcgactcgcgcaccaacctggcgctgggacgtcacttccgggccacggacctcatccac
gcgctgcggcaccggcaccggctgacccgcgagctgctggcgctcatggcggacgtggac
gtcatcgtcacgccgacgacggccagcaccgcgcccgccatccccgaggcgacgctcccc
gccggcgagtcgaacctgccggtggtggacgccctgatgcgcttcatccgcctggcgaac
ctcaccggctgccctgccctctccgtgcccgcgggcttcgaccgcgccggcctgcccgtg
ggcgtgcacctcatggggcgcccctacgaggagcacctgctgctgcgcctgggccgtgtg
gtggagcgcgcgaccgagcgccgcacgccgggcattcacgtcaacgttctgccctga

DBGET integrated database retrieval system