KEGG   Corallococcus coralloides: COCOR_00867Help
Entry
COCOR_00867       CDS       T01780                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00380  Tryptophan metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    COCOR_00867 (kynU)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     COCOR_00867 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DPRP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFE09185
UniProt: H8MK35
LinkDB All DBs
Position
complement(1018920..1020197)
Genome map
AA seq 425 aa AA seqDB search
MTAPVYENTDVFAYGLDAADPLRPLRDEFLFPPAPSGAPAIYLAGNSLGLQPRKARKYVQ
MEMEDWERLGVEGHVHGRHPWLPYHEQLTDMVARVVGAQPIEVVVMNTLSVNLHLMMVSF
YRPTRERFKILIEGGAFPSDQYAVASQARFHGYDPKEAIVRLMPREGEDTLRSEDILEAI
ERHGKELALVMLGSVNYLTGQAFDLREITRVAHAQGCKVGFDLAHAAGNLKLSLHDDGPD
FAVWCSYKYLNGGPGSLGGVFVHERHAHSPQLPRFEGWWGHNKATRFEMGPTFDPLPGAE
GWQLSNPPIFQLAALRSSLELFDKATMAALRTKSDQLTGYLEFLLDRLPAGYVSITTPRD
LKQRGAQLSLRFKGEPKRLLQRLSAAGIICDFREPDIIRAAPTPLYNTYLDVFRFVKALE
AHALE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccctgtctacgagaacaccgatgtgttcgcctacggcctggacgcagcggat
ccgctgaggcccctgcgcgacgagttcctcttcccgcccgccccctccggcgcgccggcc
atctacctggcgggcaattcgctggggctgcagccgcgcaaggcgcgcaagtacgtgcag
atggagatggaggactgggagcggctgggcgtggagggccacgtacacggccgccacccg
tggctgccctaccacgagcagctcaccgacatggtggcgcgggtggtgggcgcgcagccc
attgaagtcgtggtgatgaacaccctgtcggtgaacctgcacctgatgatggtgtcgttc
taccggcccacgcgcgagcgcttcaagatcctgattgaaggcggcgccttcccgtcggac
cagtacgcggtggcatcgcaggcgcgcttccacggctacgacccgaaggaggccatcgtc
cggctgatgccccgtgagggcgaggacacgctgcgctccgaggacatcctggaggccatc
gagcggcacgggaaggagctcgcgctggtgatgctgggcagcgtgaactacctcaccggg
caggcgttcgacctgcgcgagatcacgcgcgtggcgcacgcgcagggctgcaaggtgggc
ttcgacctggcgcacgcggcgggcaacctgaagctgtcgctgcacgacgacgggccggac
ttcgcggtgtggtgttcgtacaagtacctcaacggcggaccgggcagcctgggcggcgtg
ttcgtgcacgagcgccacgcgcactcgccccagctgccgcgcttcgagggctggtgggga
cacaacaaggccacgcgcttcgagatgggccccaccttcgacccgctgccgggcgcggag
gggtggcagctgtccaacccgcccatcttccagctggcggcgctgcgctcgtcgctggag
ctgttcgacaaggcgacgatggcggcgttgcgcaccaagagcgaccagctgacgggctac
ctggagttcctcctggaccggctgcccgcgggctacgtctccatcaccacgccgcgagac
ttgaagcagcgtggggcgcagctgtccctgcgcttcaagggcgagccgaagcggctgctc
cagcggctgtccgcggccggcatcatctgcgacttccgcgagccggacatcatccgcgcc
gcgcccacgcccctctacaacacgtacctggacgtcttccgcttcgtgaaggcgctggag
gcccatgccctcgaatga

DBGET integrated database retrieval system