KEGG   Corallococcus coralloides: COCOR_00956Help
Entry
COCOR_00956       CDS       T01780                                 

Gene name
ligD
Definition
(GenBank) ATP dependent DNA ligase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFE09218
UniProt: H8MLH4
LinkDB All DBs
Position
complement(1149678..1152236)
Genome map
AA seq 852 aa AA seqDB search
MKTSDTQRRLRRYRTKRDFHLTPEPSPDAKAPKSSAPVFVIHKHDATRLHYDLRLEIGGV
LVSWAIPKGPSHDPSVKRLAVQTEDHPRSYADFEGHIPDDQYGGGDSLLWESGTFEVVPP
GDAEAQLKRGHLEVVLHGAKLKGRWHLIRTRPRGGKAQWLFFKAKDDYAKAGYDVTVERP
ESVKSGQVETQGPRKPGVLRNKKPAAPVRKAAKKPARLPSTPEKLLERVWPPMLARLAVS
DEVHDETHAYEVKYDGFRAVCALTHGKIAFQSRRGNDLSGRFARLTAALRELPAKDVVVD
GEIVALDAKGRSRFQILQNTEEGAEQRFMVFDLLWLDGEDLRELPYEERRARLEKLMAGA
QLPLQLSEKVDLPLSRGLLEARRKGWEGLIAKRKDSPYTGTRSGDWLKLKVVAGQEVVIL
GYLPIKNAKAKSEIGALRVGVRGKEGFHDVGKVGTGYTSKDRRELRWLLDATRVKKPAAV
DAPTNTDTVWVKPKYVAQVNFTEWTKDGRLRHPVFQGLRSDKVPQEVVREHPAPIEGAAR
RGSRRAPVQAAARTAKAPAVKTPRGKSRHAPEVVLTHGDRVLFPQAGLTKADVFAYYEQA
APLLLPVLADRPLAHQQWPGGIQAPGFFRHELSGIPAWMPTLRVRHEDKTLRHVNVKDTS
ALLWLANQSALTLHMWLSHAPRLAQPDFVVFDLDPGEGGWKDVVKVATLLHARLDELGLK
SFPKTSGKRGLHVLVPLAPGHTYARTQAFADARARELEEELGDIATTERSIRERGGRLYI
DAGQNARGKTVVAPYSLRAVEGAPFSAPLEWSEVNSRLDPHRFRLKTLKKRLDAVGDLFA
PVLRVKQVLPDE
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacctccgacacccagaggcggctgcgccgctaccggacgaagcgcgacttccac
ctcacgcccgaaccgtcgccggacgcgaaggccccgaagtcgagcgcgcccgtcttcgtc
atccacaagcatgacgccacgcggctgcactacgacctgcgcctggagattggcggcgtg
ctggtgagctgggccattcccaagggccccagccacgacccttccgtgaagcggctcgcg
gtccagacggaggaccacccgcgctcctacgcggacttcgagggccacatcccggatgac
cagtacggcggcggggattcgctgctctgggagtccggaaccttcgaggtcgtgcctccc
ggcgacgccgaggcgcagctgaagcgcgggcacctggaggtcgtgctgcacggcgcgaag
ctcaaggggcgctggcacctcatccgcacgcgtccgcgcggtggcaaggcgcagtggctc
ttcttcaaggcgaaggacgactacgccaaggccggctacgacgtcaccgtggagcgcccc
gagtccgtgaagagcggacaggtggagacgcaagggcctcgcaagcccggcgtgctgcgc
aacaagaagcccgcggcgcccgtgcgcaaggccgcgaagaagccggcccgtctcccctcg
acgccggagaagctgctggagcgcgtgtggccgcccatgctggcgcggctggccgtgtcc
gacgaggtgcacgacgaaacgcacgcctacgaggtgaagtacgacggcttccgcgccgtg
tgcgcgctcacgcacggaaaaatcgccttccagagccgccggggcaacgacctgtcgggc
cgcttcgcccggctcaccgccgcgctgcgggagctgcccgcgaaggacgtcgtcgtggac
ggagagattgtcgcgctcgacgcgaagggccgctcgcgcttccagattctccagaacacg
gaagagggcgcggagcagcgcttcatggtgttcgatctgctgtggctggacggcgaggac
ctgcgcgagcttccctacgaggagcgccgcgcgcggctggagaagctgatggccggggcg
cagctgcccctgcagctctccgagaaggtggacctgccgctgtcgcggggcctgctggag
gcccggcgcaaggggtgggaggggctcatcgccaagcgcaaggactcgccgtacacgggc
acgcgctccggggactggctgaagctgaaggtggtcgcgggccaggaggtcgtcatcctg
ggctacctgcccatcaagaacgcgaaggcgaagtcggagattggcgcgctgcgcgtgggc
gtgcgcggcaaggaaggcttccacgacgtgggcaaggtgggcacgggctacacgtcaaag
gaccgccgcgagctgcgctggctgctggacgccacgcgcgtgaagaagcccgccgccgtg
gacgcgcccacgaacacggacaccgtctgggtgaagccgaagtacgtggcccaggtgaac
ttcaccgaatggaccaaggacggccgcctgcgccaccccgtgttccagggcctgcgcagc
gacaaggtgccgcaggaggtcgtgcgcgaacaccccgcccccatcgaaggcgccgcacgc
cggggctcgcggcgcgcgccggtgcaggccgccgcccgcaccgcgaaggcgcccgccgtg
aagacgccgcgcgggaagtcccggcacgcgccggaggtggtcctcacgcacggcgaccgc
gtgctgttcccccaagccggcctgacgaaggcggacgtgttcgcgtactacgagcaggca
gcgccgctgctattgcccgtgctcgcggaccggcccctggcccatcagcagtggcccggg
ggcatccaggccccgggcttcttccggcacgagctgtccggcatccccgcgtggatgccc
acgttgcgcgtgcgccacgaggacaagacgctgcgccacgtgaacgtgaaggacacgtcc
gcgctcctgtggctcgccaaccagtccgcgctcacgctgcacatgtggctgtcccacgcg
ccccggctggcgcagccggacttcgtggtgttcgacctggaccctggcgagggcggctgg
aaggacgtggtgaaggtggccaccctgctgcacgcgcgcctggacgagctggggctcaag
tccttcccgaagacctccggcaagcgcggcctgcacgtgctggtgcccctggcgccgggc
cacacctacgcgcgcacccaggcgttcgcggacgcgcgggcgcgtgagctggaggaggag
ctgggcgacatcgccaccacggagcgctccatccgcgagcgcggcgggcggctctacatc
gacgcgggccagaacgcgcgcggcaagacggtggtggcgccctactccctgcgcgccgtg
gagggcgcgcccttctccgcgccgctcgaatggagcgaggtgaacagccgcctggacccg
caccgcttccgcctgaagacgctgaagaagcgcctggatgccgtgggggacctgttcgcg
cccgtgctccgggtgaagcaggtgctgccagacgagtga

DBGET integrated database retrieval system